BLASTX nr result
ID: Rehmannia26_contig00019421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00019421 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504888.1| PREDICTED: LL-diaminopimelate aminotransfera... 59 9e-07 ref|XP_006347293.1| PREDICTED: LL-diaminopimelate aminotransfera... 58 2e-06 ref|XP_004241409.1| PREDICTED: probable LL-diaminopimelate amino... 58 2e-06 gb|EOX97269.1| Pyridoxal phosphate (PLP)-dependent transferases ... 57 2e-06 gb|EPS64827.1| hypothetical protein M569_09950 [Genlisea aurea] 57 3e-06 gb|AFK38892.1| unknown [Medicago truncatula] 57 3e-06 gb|ACJ85329.1| unknown [Medicago truncatula] 57 3e-06 ref|XP_003608321.1| LL-diaminopimelate aminotransferase [Medicag... 57 3e-06 ref|XP_006855455.1| hypothetical protein AMTR_s00057p00178040 [A... 56 4e-06 dbj|BAJ90564.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 ref|XP_003562695.1| PREDICTED: LL-diaminopimelate aminotransfera... 55 7e-06 >ref|XP_004504888.1| PREDICTED: LL-diaminopimelate aminotransferase, chloroplastic-like [Cicer arietinum] Length = 459 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 94 DKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 D AYKTKVSRNEN+ KLQAGYLFPEIARRR+ Sbjct: 50 DTAYKTKVSRNENMGKLQAGYLFPEIARRRS 80 >ref|XP_006347293.1| PREDICTED: LL-diaminopimelate aminotransferase, chloroplastic-like [Solanum tuberosum] Length = 461 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 103 ATSDKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 +T +YKT+VSRNENLAKLQAGYLFPEIARRR+ Sbjct: 49 STEKTSYKTQVSRNENLAKLQAGYLFPEIARRRS 82 >ref|XP_004241409.1| PREDICTED: probable LL-diaminopimelate aminotransferase, chloroplastic-like [Solanum lycopersicum] Length = 461 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 103 ATSDKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 +T +YKT+VSRNENLAKLQAGYLFPEIARRR+ Sbjct: 49 STEKTSYKTQVSRNENLAKLQAGYLFPEIARRRS 82 >gb|EOX97269.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily protein [Theobroma cacao] Length = 477 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 91 KAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 +AYKTKVSRN N+AKLQAGYLFPE+ARRRA Sbjct: 69 EAYKTKVSRNSNIAKLQAGYLFPEVARRRA 98 >gb|EPS64827.1| hypothetical protein M569_09950 [Genlisea aurea] Length = 615 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 94 DKAYKTKVSRNENLAKLQAGYLFPEIARRR 5 + AYKTKVSRN+N+AKLQAGYLFPEIARRR Sbjct: 206 ETAYKTKVSRNQNMAKLQAGYLFPEIARRR 235 >gb|AFK38892.1| unknown [Medicago truncatula] Length = 260 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 SDKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 ++ AYKT+VSRNENL KLQAGYLFPEIARRR+ Sbjct: 49 AETAYKTRVSRNENLGKLQAGYLFPEIARRRS 80 >gb|ACJ85329.1| unknown [Medicago truncatula] Length = 186 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 SDKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 ++ AYKT+VSRNENL KLQAGYLFPEIARRR+ Sbjct: 49 AETAYKTRVSRNENLGKLQAGYLFPEIARRRS 80 >ref|XP_003608321.1| LL-diaminopimelate aminotransferase [Medicago truncatula] gi|355509376|gb|AES90518.1| LL-diaminopimelate aminotransferase [Medicago truncatula] Length = 459 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 SDKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 ++ AYKT+VSRNENL KLQAGYLFPEIARRR+ Sbjct: 49 AETAYKTRVSRNENLGKLQAGYLFPEIARRRS 80 >ref|XP_006855455.1| hypothetical protein AMTR_s00057p00178040 [Amborella trichopoda] gi|548859221|gb|ERN16922.1| hypothetical protein AMTR_s00057p00178040 [Amborella trichopoda] Length = 460 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 85 YKTKVSRNENLAKLQAGYLFPEIARRR 5 YKTKVSRNEN+AKLQAGYLFPEIARRR Sbjct: 54 YKTKVSRNENMAKLQAGYLFPEIARRR 80 >dbj|BAJ90564.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 461 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 97 SDKAYKTKVSRNENLAKLQAGYLFPEIARRRA 2 +D +Y TKVSRN N+AKLQAGYLFPEIARRRA Sbjct: 51 ADASYTTKVSRNANIAKLQAGYLFPEIARRRA 82 >ref|XP_003562695.1| PREDICTED: LL-diaminopimelate aminotransferase, chloroplastic-like [Brachypodium distachyon] Length = 459 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 97 SDKAYKTKVSRNENLAKLQAGYLFPEIARRR 5 +D AY TKVSRN N+AKLQAGYLFPEIARRR Sbjct: 49 ADTAYTTKVSRNANIAKLQAGYLFPEIARRR 79