BLASTX nr result
ID: Rehmannia26_contig00019384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00019384 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006478087.1| PREDICTED: uncharacterized protein LOC102628... 60 2e-07 ref|XP_006441272.1| hypothetical protein CICLE_v10018632mg [Citr... 60 4e-07 ref|XP_006441271.1| hypothetical protein CICLE_v10018632mg [Citr... 60 4e-07 ref|XP_006441269.1| hypothetical protein CICLE_v10018632mg [Citr... 60 4e-07 ref|XP_006441268.1| hypothetical protein CICLE_v10018632mg [Citr... 60 4e-07 ref|XP_002521299.1| hypothetical protein RCOM_0756330 [Ricinus c... 60 4e-07 >ref|XP_006478087.1| PREDICTED: uncharacterized protein LOC102628429 [Citrus sinensis] Length = 1065 Score = 60.5 bits (145), Expect = 2e-07 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 2/112 (1%) Frame = -3 Query: 330 TMIKAIHNLSELLLFHLSGDACSLEEENSENLKHVISNLHSCLNNKIVQVSNKPE--LNN 157 T+I ++HNLSELLLFH S D C L+E + E LK V++NL C++ ++ + E L Sbjct: 632 TLISSMHNLSELLLFHCSNDMCGLKEHDFEALKLVVNNLDKCISKRMGPEAPIQESLLTQ 691 Query: 156 LVGDTSEKLPESRGVGTMLASPHTTNESSDSHIKLDYQHMHQNERNFSFSGK 1 + + PE G ++SP T + + +YQH+ + +GK Sbjct: 692 KSSEFIREFPELH-EGVTVSSPQETKAAFSVLNQPNYQHVQEQRSPDIAAGK 742 >ref|XP_006441272.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] gi|557543534|gb|ESR54512.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] Length = 842 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%) Frame = -3 Query: 330 TMIKAIHNLSELLLFHLSGDACSLEEENSENLKHVISNLHSCLNNKIVQVSNKPE--LNN 157 T+I +HNLSELLLFH S D C L+E + E LK V++NL C++ ++ + E L Sbjct: 631 TLISTMHNLSELLLFHCSNDMCGLKEHDFEALKLVVNNLDKCISKRMGPEAPIQESLLTQ 690 Query: 156 LVGDTSEKLPESRGVGTMLASPHTTNESSDSHIKLDYQHMHQNERNFSFSGK 1 + + PE G ++SP T + + +YQH+ + +GK Sbjct: 691 KSSEFIREFPELH-EGVTVSSPKETKAAFSVLNQPNYQHVQEQRSPDIAAGK 741 >ref|XP_006441271.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] gi|557543533|gb|ESR54511.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] Length = 1064 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%) Frame = -3 Query: 330 TMIKAIHNLSELLLFHLSGDACSLEEENSENLKHVISNLHSCLNNKIVQVSNKPE--LNN 157 T+I +HNLSELLLFH S D C L+E + E LK V++NL C++ ++ + E L Sbjct: 631 TLISTMHNLSELLLFHCSNDMCGLKEHDFEALKLVVNNLDKCISKRMGPEAPIQESLLTQ 690 Query: 156 LVGDTSEKLPESRGVGTMLASPHTTNESSDSHIKLDYQHMHQNERNFSFSGK 1 + + PE G ++SP T + + +YQH+ + +GK Sbjct: 691 KSSEFIREFPELH-EGVTVSSPKETKAAFSVLNQPNYQHVQEQRSPDIAAGK 741 >ref|XP_006441269.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] gi|567897564|ref|XP_006441270.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] gi|557543531|gb|ESR54509.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] gi|557543532|gb|ESR54510.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] Length = 807 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%) Frame = -3 Query: 330 TMIKAIHNLSELLLFHLSGDACSLEEENSENLKHVISNLHSCLNNKIVQVSNKPE--LNN 157 T+I +HNLSELLLFH S D C L+E + E LK V++NL C++ ++ + E L Sbjct: 631 TLISTMHNLSELLLFHCSNDMCGLKEHDFEALKLVVNNLDKCISKRMGPEAPIQESLLTQ 690 Query: 156 LVGDTSEKLPESRGVGTMLASPHTTNESSDSHIKLDYQHMHQNERNFSFSGK 1 + + PE G ++SP T + + +YQH+ + +GK Sbjct: 691 KSSEFIREFPELH-EGVTVSSPKETKAAFSVLNQPNYQHVQEQRSPDIAAGK 741 >ref|XP_006441268.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] gi|557543530|gb|ESR54508.1| hypothetical protein CICLE_v10018632mg [Citrus clementina] Length = 1041 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%) Frame = -3 Query: 330 TMIKAIHNLSELLLFHLSGDACSLEEENSENLKHVISNLHSCLNNKIVQVSNKPE--LNN 157 T+I +HNLSELLLFH S D C L+E + E LK V++NL C++ ++ + E L Sbjct: 631 TLISTMHNLSELLLFHCSNDMCGLKEHDFEALKLVVNNLDKCISKRMGPEAPIQESLLTQ 690 Query: 156 LVGDTSEKLPESRGVGTMLASPHTTNESSDSHIKLDYQHMHQNERNFSFSGK 1 + + PE G ++SP T + + +YQH+ + +GK Sbjct: 691 KSSEFIREFPELH-EGVTVSSPKETKAAFSVLNQPNYQHVQEQRSPDIAAGK 741 >ref|XP_002521299.1| hypothetical protein RCOM_0756330 [Ricinus communis] gi|223539484|gb|EEF41073.1| hypothetical protein RCOM_0756330 [Ricinus communis] Length = 1125 Score = 59.7 bits (143), Expect = 4e-07 Identities = 40/117 (34%), Positives = 65/117 (55%), Gaps = 7/117 (5%) Frame = -3 Query: 330 TMIKAIHNLSELLLFHLSGDACSLEEENSENLKHVISNLHSCLNNKIVQVSNKPEL---- 163 T+I + NLSELL+FHLS D C L+E++S LK +ISNL C+ + ++++ E Sbjct: 675 TVIDTMQNLSELLIFHLSNDLCDLKEDDSNALKGMISNLELCMLKNVERMTSTQESIIPE 734 Query: 162 ---NNLVGDTSEKLPESRGVGTMLASPHTTNESSDSHIKLDYQHMHQNERNFSFSGK 1 L G +S+ + G G ++ + ++ + + YQH+ Q+E N S SGK Sbjct: 735 RDGAQLSGKSSKLQKGTNGNGFLI----SRSDPLEFQYSVKYQHV-QDEHNIS-SGK 785