BLASTX nr result
ID: Rehmannia26_contig00019015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00019015 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ01815.1| hypothetical protein PRUPE_ppa008004mg [Prunus pe... 57 2e-06 gb|ADL36590.1| BHLH domain class transcription factor [Malus dom... 57 2e-06 ref|XP_002521010.1| DNA binding protein, putative [Ricinus commu... 56 6e-06 gb|EPS74560.1| hypothetical protein M569_00194, partial [Genlise... 55 7e-06 >gb|EMJ01815.1| hypothetical protein PRUPE_ppa008004mg [Prunus persica] Length = 349 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = -1 Query: 428 SHPVSRVIEALREEQVTEQESVITVSDDGEVVHTFSVRTEGGGAE 294 SHPVS VI+ LRE ++ QES ++++D+ +V+HTFS+ T+GG AE Sbjct: 293 SHPVSEVIKTLREHKIVAQESNVSITDNDKVIHTFSIPTQGGDAE 337 >gb|ADL36590.1| BHLH domain class transcription factor [Malus domestica] Length = 502 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = -1 Query: 428 SHPVSRVIEALREEQVTEQESVITVSDDGEVVHTFSVRTEGGGAE 294 SHPVS VI LRE ++ QES ++++D+ +V+HTFS++T+GG AE Sbjct: 446 SHPVSDVIRTLREHKIVPQESNVSITDNDKVIHTFSIQTQGGDAE 490 >ref|XP_002521010.1| DNA binding protein, putative [Ricinus communis] gi|223539847|gb|EEF41427.1| DNA binding protein, putative [Ricinus communis] Length = 503 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/44 (50%), Positives = 35/44 (79%) Frame = -1 Query: 425 HPVSRVIEALREEQVTEQESVITVSDDGEVVHTFSVRTEGGGAE 294 HPVS ++E+ RE QVT QE ++ +++ +++HTFS+RT+GG AE Sbjct: 448 HPVSSILESFREHQVTAQECNMSAAENDKIIHTFSIRTQGGAAE 491 >gb|EPS74560.1| hypothetical protein M569_00194, partial [Genlisea aurea] Length = 439 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 428 SHPVSRVIEALREEQVTEQESVITVSDDGEVVHTFSVRTEGG 303 SHPVS V++ALR+ QVT S ++V++ GEVVHTFS+RT G Sbjct: 381 SHPVSGVVKALRQHQVTPHRSTLSVTEGGEVVHTFSIRTTRG 422