BLASTX nr result
ID: Rehmannia26_contig00018575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00018575 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] 80 4e-13 gb|ABR16782.1| unknown [Picea sitchensis] 57 3e-06 ref|XP_002509440.1| pentatricopeptide repeat-containing protein,... 55 1e-05 >gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] Length = 44 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 129 MLEFFLLGCTGVVVFLHGANFFFHALSSHLAIRAISFLGFVAW 257 M+E F+LGCTGVVVFLHGANFFFH LS HLA+R++SFLGFV W Sbjct: 2 MVELFVLGCTGVVVFLHGANFFFHILSQHLAVRSLSFLGFVGW 44 >gb|ABR16782.1| unknown [Picea sitchensis] Length = 41 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +3 Query: 144 LLGCTGVVVFLHGANFFFHALSSHLAIRAISFLGFV 251 LLGCTGV+VF+HGANFFF+ + H+A+RA++FL V Sbjct: 5 LLGCTGVIVFIHGANFFFNYICKHVAVRALTFLSHV 40 >ref|XP_002509440.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549339|gb|EEF50827.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/37 (67%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = +3 Query: 129 MLEFFLLG--CTGVVVFLHGANFFFHALSSHLAIRAI 233 ++E F+LG CTGVV+FLHGANFFFH LS HLA R++ Sbjct: 2 VVEIFVLGMGCTGVVMFLHGANFFFHVLSHHLAFRSL 38