BLASTX nr result
ID: Rehmannia26_contig00018356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00018356 (487 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004957888.1| PREDICTED: glucose-6-phosphate/phosphate tra... 77 3e-12 tpg|DAA41023.1| TPA: hypothetical protein ZEAMMB73_640449 [Zea m... 77 3e-12 tpg|DAA62951.1| TPA: glucose-6-phosphate/phosphate translocator ... 77 3e-12 ref|XP_002462940.1| hypothetical protein SORBIDRAFT_02g034980 [S... 77 3e-12 ref|NP_001147439.1| glucose-6-phosphate/phosphate translocator 2... 77 3e-12 gb|EPS59356.1| hypothetical protein M569_15451, partial [Genlise... 75 7e-12 ref|XP_006302377.1| hypothetical protein CARUB_v10020443mg [Caps... 75 7e-12 ref|NP_564785.1| glucose-6-phosphate/phosphate translocator 2 [A... 75 7e-12 gb|AAK68814.1| Similar to glucose-6-phosphate/phosphate-transloc... 75 7e-12 ref|XP_002888066.1| glucose-6-phosphate/phosphate translocator 2... 75 7e-12 dbj|BAD94591.1| Similar to glucose-6-phosphate/phosphate-translo... 75 7e-12 gb|ACV60359.1| putative glucose-6-phosphate/phosphate translocat... 75 9e-12 dbj|BAC57673.1| putative glucose-6-phosphate/phosphate- transloc... 75 1e-11 ref|XP_006657775.1| PREDICTED: glucose-6-phosphate/phosphate tra... 75 1e-11 gb|EMT13790.1| Glucose-6-phosphate/phosphate translocator 2, chl... 75 1e-11 gb|EMS59907.1| hypothetical protein TRIUR3_26958 [Triticum urartu] 75 1e-11 ref|XP_003560140.1| PREDICTED: glucose-6-phosphate/phosphate tra... 75 1e-11 gb|EEE67296.1| hypothetical protein OsJ_24501 [Oryza sativa Japo... 75 1e-11 ref|NP_001059819.1| Os07g0523600 [Oryza sativa Japonica Group] g... 75 1e-11 ref|XP_006493943.1| PREDICTED: glucose-6-phosphate/phosphate tra... 74 2e-11 >ref|XP_004957888.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like isoform X1 [Setaria italica] Length = 388 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIFQTP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 347 TMKRISVIVASIIIFQTPVQPINALGAAIAILGTFIYSQAKQ 388 >tpg|DAA41023.1| TPA: hypothetical protein ZEAMMB73_640449 [Zea mays] Length = 394 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIFQTP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 353 TMKRISVIVASIIIFQTPVQPINALGAAIAILGTFIYSQAKQ 394 >tpg|DAA62951.1| TPA: glucose-6-phosphate/phosphate translocator 2 [Zea mays] Length = 391 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIFQTP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 350 TMKRISVIVASIIIFQTPVQPINALGAAIAILGTFIYSQAKQ 391 >ref|XP_002462940.1| hypothetical protein SORBIDRAFT_02g034980 [Sorghum bicolor] gi|241926317|gb|EER99461.1| hypothetical protein SORBIDRAFT_02g034980 [Sorghum bicolor] Length = 395 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIFQTP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 354 TMKRISVIVASIIIFQTPVQPINALGAAIAILGTFIYSQAKQ 395 >ref|NP_001147439.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays] gi|195611380|gb|ACG27520.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays] Length = 400 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIFQTP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 359 TMKRISVIVASIIIFQTPVQPINALGAAIAILGTFIYSQAKQ 400 >gb|EPS59356.1| hypothetical protein M569_15451, partial [Genlisea aurea] Length = 74 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIV+SIIIFQTP+QP+NALGAAIA+ GTFLYSQAKQ Sbjct: 33 TMKRISVIVSSIIIFQTPVQPVNALGAAIAVLGTFLYSQAKQ 74 >ref|XP_006302377.1| hypothetical protein CARUB_v10020443mg [Capsella rubella] gi|482571087|gb|EOA35275.1| hypothetical protein CARUB_v10020443mg [Capsella rubella] Length = 388 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QP+NALGAAIAI GTFLYSQAKQ Sbjct: 347 TMKRISVIVASIIIFHTPIQPVNALGAAIAILGTFLYSQAKQ 388 >ref|NP_564785.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana] gi|325511333|sp|Q94B38.2|GPT2_ARATH RecName: Full=Glucose-6-phosphate/phosphate translocator 2, chloroplastic; Flags: Precursor gi|332195767|gb|AEE33888.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana] Length = 388 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QP+NALGAAIAI GTFLYSQAKQ Sbjct: 347 TMKRISVIVASIIIFHTPIQPVNALGAAIAIFGTFLYSQAKQ 388 >gb|AAK68814.1| Similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis thaliana] gi|20148301|gb|AAM10041.1| similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis thaliana] Length = 388 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QP+NALGAAIAI GTFLYSQAKQ Sbjct: 347 TMKRISVIVASIIIFHTPIQPVNALGAAIAIFGTFLYSQAKQ 388 >ref|XP_002888066.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis lyrata subsp. lyrata] gi|297333907|gb|EFH64325.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis lyrata subsp. lyrata] Length = 388 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QP+NALGAAIAI GTFLYSQAKQ Sbjct: 347 TMKRISVIVASIIIFHTPIQPVNALGAAIAILGTFLYSQAKQ 388 >dbj|BAD94591.1| Similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis thaliana] Length = 110 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QP+NALGAAIAI GTFLYSQAKQ Sbjct: 69 TMKRISVIVASIIIFHTPIQPVNALGAAIAIFGTFLYSQAKQ 110 >gb|ACV60359.1| putative glucose-6-phosphate/phosphate translocator [Camellia sinensis] Length = 401 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASII+FQTPLQPINALGAAIAI GTFLYSQ K+ Sbjct: 360 TMKRISVIVASIIVFQTPLQPINALGAAIAIFGTFLYSQTKK 401 >dbj|BAC57673.1| putative glucose-6-phosphate/phosphate- translocator precursor [Oryza sativa Japonica Group] gi|28564763|dbj|BAC57677.1| putative glucose-6-phosphate/phosphate- translocator precursor [Oryza sativa Japonica Group] gi|50508555|dbj|BAD30854.1| putative glucose-6-phosphate/phosphate- translocator precursor [Oryza sativa Japonica Group] Length = 392 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 351 TMKRISVIVASIIIFHTPVQPINALGAAIAILGTFIYSQAKQ 392 >ref|XP_006657775.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like, partial [Oryza brachyantha] Length = 325 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 284 TMKRISVIVASIIIFHTPVQPINALGAAIAILGTFIYSQAKQ 325 >gb|EMT13790.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Aegilops tauschii] Length = 384 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF+TP+QP+NALGAAIAI GTF+YSQAKQ Sbjct: 343 TMKRISVIVASIIIFRTPVQPVNALGAAIAILGTFIYSQAKQ 384 >gb|EMS59907.1| hypothetical protein TRIUR3_26958 [Triticum urartu] Length = 249 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF+TP+QP+NALGAAIAI GTF+YSQAKQ Sbjct: 208 TMKRISVIVASIIIFRTPVQPVNALGAAIAILGTFIYSQAKQ 249 >ref|XP_003560140.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like [Brachypodium distachyon] Length = 480 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 439 TMKRISVIVASIIIFHTPVQPINALGAAIAILGTFIYSQAKQ 480 >gb|EEE67296.1| hypothetical protein OsJ_24501 [Oryza sativa Japonica Group] Length = 426 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 385 TMKRISVIVASIIIFHTPVQPINALGAAIAILGTFIYSQAKQ 426 >ref|NP_001059819.1| Os07g0523600 [Oryza sativa Japonica Group] gi|113611355|dbj|BAF21733.1| Os07g0523600, partial [Oryza sativa Japonica Group] Length = 275 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIVASIIIF TP+QPINALGAAIAI GTF+YSQAKQ Sbjct: 234 TMKRISVIVASIIIFHTPVQPINALGAAIAILGTFIYSQAKQ 275 >ref|XP_006493943.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like [Citrus sinensis] Length = 391 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 487 TMKRISVIVASIIIFQTPLQPINALGAAIAISGTFLYSQAKQ 362 TMKRISVIV+SIIIF TP+QPINALGAAIAI GTFLYSQAKQ Sbjct: 350 TMKRISVIVSSIIIFHTPVQPINALGAAIAILGTFLYSQAKQ 391