BLASTX nr result
ID: Rehmannia26_contig00018074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00018074 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482641.1| PREDICTED: uncharacterized membrane protein ... 57 2e-06 gb|EMJ17520.1| hypothetical protein PRUPE_ppa019884mg [Prunus pe... 55 7e-06 >ref|XP_006482641.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform X1 [Citrus sinensis] gi|568858200|ref|XP_006482642.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform X2 [Citrus sinensis] gi|568858202|ref|XP_006482643.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform X3 [Citrus sinensis] gi|568858204|ref|XP_006482644.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform X4 [Citrus sinensis] Length = 714 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +3 Query: 3 RIDQMDPTISSFYDKLSTAYRDPAMKPHRYSETGESSNSPLLHGAD 140 R DQ DPT++ FY+KL TAY+DPA+ P +YS + + SPLLH A+ Sbjct: 668 REDQNDPTMAEFYEKLVTAYQDPALMPVQYSGSSDERTSPLLHAAN 713 >gb|EMJ17520.1| hypothetical protein PRUPE_ppa019884mg [Prunus persica] Length = 757 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +3 Query: 3 RIDQMDPTISSFYDKLSTAYRDPAMKPHRYSETGESSNSPLL 128 R DQ DPTI+ FYDKL TAY+DPA+ P R+ + + NSPLL Sbjct: 712 REDQNDPTIAVFYDKLRTAYKDPALMPKRHPRSTDDHNSPLL 753