BLASTX nr result
ID: Rehmannia26_contig00018008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00018008 (356 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509829.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002509829.1| conserved hypothetical protein [Ricinus communis] gi|223549728|gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%) Frame = +2 Query: 59 SYVPENYRSLIQAMITFVIVLHDKAYKSLLNGFSGQNLVVLDGSLKFWKAADPTPV--TM 232 +YVP YR LI++M+TFV+ +HD Y + GF N+V+ + +KFWK T + Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTA--GFGMPNIVIKNEVVKFWKVQFITASMGSK 168 Query: 233 KNDLR*LYHVPTNKLSTGGYTAIPSDMDHLI 325 ND L+ V + S + +P +M H + Sbjct: 169 NNDFICLHRVVESLFSGEQHLHLPREMQHFL 199