BLASTX nr result
ID: Rehmannia26_contig00017851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00017851 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73306.1| hypothetical protein M569_01453, partial [Genlise... 60 4e-07 ref|XP_006426258.1| hypothetical protein CICLE_v10026840mg [Citr... 56 6e-06 ref|XP_002533956.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >gb|EPS73306.1| hypothetical protein M569_01453, partial [Genlisea aurea] Length = 69 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 DEMKKFVLVMEILETYLRRRYREQQDHFFQLYSS 102 +EMKKFV VMEILETYLRRRYREQQDH L+SS Sbjct: 36 EEMKKFVRVMEILETYLRRRYREQQDHLVSLFSS 69 >ref|XP_006426258.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] gi|567867273|ref|XP_006426259.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] gi|568823852|ref|XP_006466322.1| PREDICTED: protein SKIP34-like [Citrus sinensis] gi|557528248|gb|ESR39498.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] gi|557528249|gb|ESR39499.1| hypothetical protein CICLE_v10026840mg [Citrus clementina] Length = 96 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 DEMKKFVLVMEILETYLRRRYREQQDHFFQLYSSPP 108 +EMK+FV VMEILETYL+RR+REQQ+H L+SS P Sbjct: 59 EEMKRFVSVMEILETYLKRRFREQQEHLVHLFSSIP 94 >ref|XP_002533956.1| conserved hypothetical protein [Ricinus communis] gi|223526069|gb|EEF28425.1| conserved hypothetical protein [Ricinus communis] Length = 100 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 DEMKKFVLVMEILETYLRRRYREQQDHFFQLYSSPP 108 +EMK+FV VMEILETYL+RRYREQQ+H + +SS P Sbjct: 63 EEMKRFVSVMEILETYLKRRYREQQEHVARFFSSLP 98