BLASTX nr result
ID: Rehmannia26_contig00016787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00016787 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525478.1| hypothetical protein RCOM_1122760 [Ricinus c... 57 3e-06 >ref|XP_002525478.1| hypothetical protein RCOM_1122760 [Ricinus communis] gi|223535291|gb|EEF36968.1| hypothetical protein RCOM_1122760 [Ricinus communis] Length = 186 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/63 (53%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = -3 Query: 358 TQYFECARQAGLFRCSCSGEC-----GGSYFNHAAGDLYGVGFEKPLPRRVYAAPQRKTK 194 TQYFECARQAGL R S SGEC GGS +GDLY K P R P RKT+ Sbjct: 25 TQYFECARQAGLIRYSSSGECEQYMRGGS-GGSGSGDLYATDVRK--PSRDLGPPPRKTR 81 Query: 193 GIS 185 G+S Sbjct: 82 GVS 84