BLASTX nr result
ID: Rehmannia26_contig00016420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00016420 (655 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC25199.1| putative protein phosphatase 2C 8 [Morus notabilis] 53 4e-07 dbj|BAJ93420.1| predicted protein [Hordeum vulgare subsp. vulgare] 49 9e-06 >gb|EXC25199.1| putative protein phosphatase 2C 8 [Morus notabilis] Length = 155 Score = 53.1 bits (126), Expect(2) = 4e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 427 HGVRLATEYAQKHLHKHVLSAGLPIELVCL 516 HG RLA EYAQKHLH +VLSAGLP ELVCL Sbjct: 116 HGGRLAAEYAQKHLHANVLSAGLPRELVCL 145 Score = 27.3 bits (59), Expect(2) = 4e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 398 RCAHFAIYDG 427 RCAHFAIYDG Sbjct: 106 RCAHFAIYDG 115 >dbj|BAJ93420.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 281 Score = 48.5 bits (114), Expect(2) = 9e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +1 Query: 427 HGVRLATEYAQKHLHKHVLSAGLPIELV 510 HG RLA EYAQKHLH HV++AGLP EL+ Sbjct: 126 HGGRLAAEYAQKHLHPHVIAAGLPRELI 153 Score = 27.3 bits (59), Expect(2) = 9e-06 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 398 RCAHFAIYDG 427 RCAHFAIYDG Sbjct: 116 RCAHFAIYDG 125