BLASTX nr result
ID: Rehmannia26_contig00016171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00016171 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67054.1| hypothetical protein M569_07721, partial [Genlise... 69 7e-10 ref|XP_004297952.1| PREDICTED: uncharacterized protein LOC101295... 62 6e-08 gb|EMJ27353.1| hypothetical protein PRUPE_ppa014954mg, partial [... 62 8e-08 ref|XP_004147174.1| PREDICTED: uncharacterized protein LOC101210... 62 8e-08 gb|EOY06265.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06264.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06263.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06262.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06260.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06259.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06258.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06257.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 gb|EOY06256.1| Transducin family protein / WD-40 repeat family p... 59 9e-07 >gb|EPS67054.1| hypothetical protein M569_07721, partial [Genlisea aurea] Length = 756 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 310 QLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 +LLARRE+SP TKR+P +FW K SSR+ DS K+E KDV+QELRSW Sbjct: 28 KLLARRELSPHTKRTPNKFWKKASSRYFDSSALKNEFTKDVKQELRSW 75 >ref|XP_004297952.1| PREDICTED: uncharacterized protein LOC101295040 [Fragaria vesca subsp. vesca] Length = 764 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 F LLARREVSPQTK S ++ WGK S DS GA+ E+A+D R L SW Sbjct: 35 FSLLARREVSPQTKHSARKLWGKASKSRSDSVGARCEAARDARNGLVSW 83 >gb|EMJ27353.1| hypothetical protein PRUPE_ppa014954mg, partial [Prunus persica] Length = 758 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = +1 Query: 310 QLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 +LLARREVSPQTK S K+ WG+ S H DS G++ E+A+D R L SW Sbjct: 26 RLLARREVSPQTKNSSKKLWGEASKSHSDSIGSRCEAARDARHGLVSW 73 >ref|XP_004147174.1| PREDICTED: uncharacterized protein LOC101210946 [Cucumis sativus] gi|449509118|ref|XP_004163498.1| PREDICTED: uncharacterized protein LOC101228862 [Cucumis sativus] Length = 775 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLA+REVSPQTKR+ +RFWG R DS G + E+A+D ++ L SW Sbjct: 44 FQLLAQREVSPQTKRASRRFWGDSHDRQCDSVGPRCEAARDAKRGLISW 92 >gb|EOY06265.1| Transducin family protein / WD-40 repeat family protein isoform 10, partial [Theobroma cacao] Length = 621 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06264.1| Transducin family protein / WD-40 repeat family protein isoform 9, partial [Theobroma cacao] Length = 580 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06263.1| Transducin family protein / WD-40 repeat family protein isoform 8, partial [Theobroma cacao] Length = 594 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06262.1| Transducin family protein / WD-40 repeat family protein isoform 7 [Theobroma cacao] Length = 667 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06260.1| Transducin family protein / WD-40 repeat family protein isoform 5 [Theobroma cacao] Length = 756 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06259.1| Transducin family protein / WD-40 repeat family protein isoform 4 [Theobroma cacao] Length = 651 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06258.1| Transducin family protein / WD-40 repeat family protein isoform 3 [Theobroma cacao] Length = 715 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06257.1| Transducin family protein / WD-40 repeat family protein isoform 2 [Theobroma cacao] Length = 650 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74 >gb|EOY06256.1| Transducin family protein / WD-40 repeat family protein isoform 1 [Theobroma cacao] Length = 763 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 307 FQLLARREVSPQTKRSPKRFWGKVSSRHVDSCGAKSESAKDVRQELRSW 453 FQLLARREVSP+TKRS ++ WG+ DS G+ ++A+D R++L SW Sbjct: 26 FQLLARREVSPRTKRSSRKLWGEEPKSRHDSFGSTCQAARDARRDLLSW 74