BLASTX nr result
ID: Rehmannia26_contig00014424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00014424 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70759.1| hypothetical protein M569_04002, partial [Genlise... 63 5e-08 >gb|EPS70759.1| hypothetical protein M569_04002, partial [Genlisea aurea] Length = 430 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 194 SDRLRKP-SGSFSDASETDSSTRKYVREFHPDEAPPPPESKIKPIAPIPNEWRPNKKLKN 370 S+R++KP + SDA DS ++ YV EF P EAPP + KIK I PIP++WRP K+LKN Sbjct: 1 SNRVKKPPAAGVSDAPAEDSLSKNYVTEFLPSEAPPI-DLKIKSIPPIPDQWRPIKRLKN 59 Query: 371 L 373 L Sbjct: 60 L 60