BLASTX nr result
ID: Rehmannia26_contig00014002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00014002 (441 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270071.2| PREDICTED: histone deacetylase 9-like [Vitis... 108 1e-21 ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricin... 108 1e-21 gb|AAS79608.1| putative histone deacetylase [Ipomoea trifida] 107 1e-21 ref|XP_004172671.1| PREDICTED: histone deacetylase 9-like, parti... 107 2e-21 ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucum... 107 2e-21 emb|CBI17064.3| unnamed protein product [Vitis vinifera] 107 2e-21 ref|XP_002266492.1| PREDICTED: histone deacetylase 9 [Vitis vini... 107 2e-21 emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera] 107 2e-21 gb|EPS60971.1| histone deacetylase, partial [Genlisea aurea] 106 3e-21 ref|XP_003606237.1| Histone deacetylase [Medicago truncatula] gi... 106 3e-21 gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis] 106 4e-21 ref|XP_004300044.1| PREDICTED: histone deacetylase 9-like [Fraga... 106 4e-21 ref|XP_002300554.1| histone deacetylase-related family protein [... 106 4e-21 ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citru... 105 8e-21 ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citr... 105 8e-21 gb|ACD50313.1| histone deacetylase RPD3/HDA1 class I isoform 1 [... 105 8e-21 ref|XP_006652253.1| PREDICTED: histone deacetylase 9-like [Oryza... 103 2e-20 gb|EMJ06433.1| hypothetical protein PRUPE_ppa006053mg [Prunus pe... 103 2e-20 ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solan... 103 3e-20 ref|XP_004506146.1| PREDICTED: histone deacetylase 9-like [Cicer... 103 3e-20 >ref|XP_002270071.2| PREDICTED: histone deacetylase 9-like [Vitis vinifera] Length = 458 Score = 108 bits (269), Expect = 1e-21 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +1 Query: 289 RMRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 +MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 28 KMRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 78 >ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis] gi|223531488|gb|EEF33320.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis] Length = 429 Score = 108 bits (269), Expect = 1e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVLSY+LH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIY 50 >gb|AAS79608.1| putative histone deacetylase [Ipomoea trifida] Length = 438 Score = 107 bits (268), Expect = 1e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVL+Y LHNKME+Y Sbjct: 1 MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIY 50 >ref|XP_004172671.1| PREDICTED: histone deacetylase 9-like, partial [Cucumis sativus] Length = 219 Score = 107 bits (267), Expect = 2e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus] Length = 430 Score = 107 bits (267), Expect = 2e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >emb|CBI17064.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 107 bits (267), Expect = 2e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >ref|XP_002266492.1| PREDICTED: histone deacetylase 9 [Vitis vinifera] gi|297734674|emb|CBI16725.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 107 bits (267), Expect = 2e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera] Length = 430 Score = 107 bits (267), Expect = 2e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >gb|EPS60971.1| histone deacetylase, partial [Genlisea aurea] Length = 323 Score = 106 bits (265), Expect = 3e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 M+SKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KMEVY Sbjct: 1 MKSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEVY 50 >ref|XP_003606237.1| Histone deacetylase [Medicago truncatula] gi|355507292|gb|AES88434.1| Histone deacetylase [Medicago truncatula] Length = 430 Score = 106 bits (265), Expect = 3e-21 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH KMEVY Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEVY 50 >gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis] Length = 429 Score = 106 bits (264), Expect = 4e-21 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIY 50 >ref|XP_004300044.1| PREDICTED: histone deacetylase 9-like [Fragaria vesca subsp. vesca] Length = 430 Score = 106 bits (264), Expect = 4e-21 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH KME+Y Sbjct: 1 MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIY 50 >ref|XP_002300554.1| histone deacetylase-related family protein [Populus trichocarpa] gi|222847812|gb|EEE85359.1| histone deacetylase-related family protein [Populus trichocarpa] Length = 429 Score = 106 bits (264), Expect = 4e-21 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKDRI+YFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MRSKDRIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citrus sinensis] Length = 429 Score = 105 bits (261), Expect = 8e-21 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH KME+Y Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIY 50 >ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citrus clementina] gi|557526240|gb|ESR37546.1| hypothetical protein CICLE_v10029823mg [Citrus clementina] Length = 429 Score = 105 bits (261), Expect = 8e-21 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH KME+Y Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIY 50 >gb|ACD50313.1| histone deacetylase RPD3/HDA1 class I isoform 1 [Hordeum vulgare] Length = 430 Score = 105 bits (261), Expect = 8e-21 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 M KDRISYFYDGDVGNVYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >ref|XP_006652253.1| PREDICTED: histone deacetylase 9-like [Oryza brachyantha] Length = 430 Score = 103 bits (258), Expect = 2e-20 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 M KDRI+YFYDGDVGNVYFGP+HPMKPHRLCMTHHLVLSYELH KME+Y Sbjct: 1 MLEKDRIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIY 50 >gb|EMJ06433.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica] Length = 430 Score = 103 bits (258), Expect = 2e-20 Identities = 43/50 (86%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKD+I+YFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH KME+Y Sbjct: 1 MRSKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIY 50 >ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solanum tuberosum] Length = 430 Score = 103 bits (256), Expect = 3e-20 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSKD+ISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVL+Y LH+KMEVY Sbjct: 1 MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYGLHSKMEVY 50 >ref|XP_004506146.1| PREDICTED: histone deacetylase 9-like [Cicer arietinum] Length = 430 Score = 103 bits (256), Expect = 3e-20 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +1 Query: 292 MRSKDRISYFYDGDVGNVYFGPDHPMKPHRLCMTHHLVLSYELHNKMEVY 441 MRSK+RISYFYDGDVG+VYFGP+HPMKPHRLCMTHHLVLSY+LH +MEVY Sbjct: 1 MRSKNRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKQMEVY 50