BLASTX nr result
ID: Rehmannia26_contig00013910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00013910 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63141.1| hypothetical protein M569_11649, partial [Genlise... 91 2e-16 ref|XP_002284210.1| PREDICTED: PRA1 family protein D-like [Vitis... 64 2e-08 emb|CAN60779.1| hypothetical protein VITISV_032147 [Vitis vinifera] 64 2e-08 ref|XP_006362196.1| PREDICTED: PRA1 family protein D-like [Solan... 62 1e-07 ref|XP_004247690.1| PREDICTED: PRA1 family protein D-like [Solan... 61 2e-07 >gb|EPS63141.1| hypothetical protein M569_11649, partial [Genlisea aurea] Length = 134 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/58 (70%), Positives = 47/58 (81%) Frame = -2 Query: 363 GGLFWTGVWMRLFVSLIIGAVIVLIHGVLRAPEDSMEDSPYGSLLNVVDSPRGEYASV 190 G LFW+ VW L SLIIGAVI +IHGVLR+PEDS EDSPYGSLLN D+P G+Y+SV Sbjct: 77 GALFWSSVWSNLLTSLIIGAVIAIIHGVLRSPEDSFEDSPYGSLLNAGDNPMGDYSSV 134 >ref|XP_002284210.1| PREDICTED: PRA1 family protein D-like [Vitis vinifera] Length = 191 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 2/58 (3%) Frame = -2 Query: 357 LFWTGVWMRLFVSLIIGAVIVLIHGVLRAPEDSMED--SPYGSLLNVVDSPRGEYASV 190 L T VW+ +FVSL+IG+ +V +HG RA D+++D SPYG+LL VVDSPRG Y+ V Sbjct: 135 LVLTHVWLNVFVSLVIGSFLVCLHGAFRA-SDNLDDQESPYGALLTVVDSPRGSYSLV 191 >emb|CAN60779.1| hypothetical protein VITISV_032147 [Vitis vinifera] Length = 160 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 2/58 (3%) Frame = -2 Query: 357 LFWTGVWMRLFVSLIIGAVIVLIHGVLRAPEDSMED--SPYGSLLNVVDSPRGEYASV 190 L T VW+ +FVSL+IG+ +V +HG RA D+++D SPYG+LL VVDSPRG Y+ V Sbjct: 104 LVLTHVWLNVFVSLVIGSFLVCLHGAFRA-SDNLDDQESPYGALLTVVDSPRGSYSLV 160 >ref|XP_006362196.1| PREDICTED: PRA1 family protein D-like [Solanum tuberosum] Length = 168 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -2 Query: 342 VWMRLFVSLIIGAVIVLIHGVLRAPEDSMEDSPYGSLLNVVDSPRGEYASV 190 +WM +FVS+ G VI+ +HG LRAPED EDSPYG+LL+ +SPRG Y+ V Sbjct: 121 IWMNIFVSIGFGIVIMCVHGALRAPED-QEDSPYGALLS--ESPRGNYSIV 168 >ref|XP_004247690.1| PREDICTED: PRA1 family protein D-like [Solanum lycopersicum] Length = 168 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -2 Query: 342 VWMRLFVSLIIGAVIVLIHGVLRAPEDSMEDSPYGSLLNVVDSPRGEYASV 190 +WM +FVS+ G VI+ +HG LRAPED EDSPYG+LL+ +SPRG Y+ V Sbjct: 121 IWMNIFVSIGFGIVIMCVHGSLRAPED-QEDSPYGALLS--ESPRGNYSIV 168