BLASTX nr result
ID: Rehmannia26_contig00013628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00013628 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006419536.1| hypothetical protein CICLE_v10005737mg [Citr... 56 4e-06 ref|XP_006419535.1| hypothetical protein CICLE_v10005737mg [Citr... 56 4e-06 >ref|XP_006419536.1| hypothetical protein CICLE_v10005737mg [Citrus clementina] gi|568871768|ref|XP_006489052.1| PREDICTED: bidirectional sugar transporter SWEET17-like [Citrus sinensis] gi|557521409|gb|ESR32776.1| hypothetical protein CICLE_v10005737mg [Citrus clementina] Length = 234 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 3 PNGIGFFLGVAQLVLYAWYRIPRASKSANGTLEEGGQHEQLI 128 PNG GF LG AQLVLYA YR + SK+A ++EEG QHE LI Sbjct: 191 PNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQHEPLI 232 >ref|XP_006419535.1| hypothetical protein CICLE_v10005737mg [Citrus clementina] gi|557521408|gb|ESR32775.1| hypothetical protein CICLE_v10005737mg [Citrus clementina] Length = 194 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 3 PNGIGFFLGVAQLVLYAWYRIPRASKSANGTLEEGGQHEQLI 128 PNG GF LG AQLVLYA YR + SK+A ++EEG QHE LI Sbjct: 151 PNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQHEPLI 192