BLASTX nr result
ID: Rehmannia26_contig00011285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00011285 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-li... 62 6e-08 ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family prot... 62 1e-07 ref|XP_006601449.1| PREDICTED: methylsterol monooxygenase 1-1-li... 60 2e-07 ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-li... 59 5e-07 gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus... 59 7e-07 ref|XP_006413625.1| hypothetical protein EUTSA_v10025849mg [Eutr... 58 1e-06 ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus... 58 1e-06 ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutr... 57 2e-06 gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theob... 57 3e-06 ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-li... 57 3e-06 ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citr... 57 3e-06 ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-li... 57 3e-06 ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-li... 56 6e-06 ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Caps... 56 6e-06 gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis th... 56 6e-06 gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis t... 56 6e-06 ref|NP_192948.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis t... 56 6e-06 ref|XP_002872644.1| hypothetical protein ARALYDRAFT_911602 [Arab... 55 7e-06 gb|AFK37077.1| unknown [Medicago truncatula] 55 1e-05 ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula... 55 1e-05 >ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum tuberosum] Length = 303 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYRYQKKVLQQL+ +N EQNG Sbjct: 258 YCDYIYGTDKGYRYQKKVLQQLKGASNANGEQNG 291 >ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa] gi|550346803|gb|ERP65285.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa] Length = 304 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNGVLHDISAQGHKVD 274 YCD+IYGTDKGYR+QKK+L++L++G+++ EQNG + I+ Q K D Sbjct: 258 YCDFIYGTDKGYRFQKKLLRKLKEGVENGGEQNGGSYHIATQDLKSD 304 >ref|XP_006601449.1| PREDICTED: methylsterol monooxygenase 1-1-like [Glycine max] Length = 272 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNGVLH 304 YCDYIYGTDKGYRYQKK+LQ+L++ + + EQNG L+ Sbjct: 233 YCDYIYGTDKGYRYQKKILQKLKEELANGVEQNGGLY 269 >ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Glycine max] Length = 359 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYRYQKK+LQ+L++ + + EQNG Sbjct: 320 YCDYIYGTDKGYRYQKKILQKLKEELANGVEQNG 353 >gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris] Length = 302 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYRYQKK+LQ+L++ + ++QNG Sbjct: 258 YCDYIYGTDKGYRYQKKILQKLKEDLTYGEQQNG 291 >ref|XP_006413625.1| hypothetical protein EUTSA_v10025849mg [Eutrema salsugineum] gi|557114795|gb|ESQ55078.1| hypothetical protein EUTSA_v10025849mg [Eutrema salsugineum] Length = 298 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYR+QKK+LQQ+++ K + +QNG Sbjct: 260 YCDYIYGTDKGYRFQKKLLQQIKEESKKSNKQNG 293 >ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus communis] gi|223549522|gb|EEF51010.1| C-4 methyl sterol oxidase, putative [Ricinus communis] Length = 243 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNGVLHDISAQGHKVD 274 YCD+IYGTDKGYR+QKKV+++L++G+++ QNG + S Q K D Sbjct: 197 YCDFIYGTDKGYRFQKKVIKKLKEGLENGGNQNGGSYYDSTQDLKSD 243 >ref|XP_006396795.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum] gi|557097812|gb|ESQ38248.1| hypothetical protein EUTSA_v10028846mg [Eutrema salsugineum] Length = 298 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/39 (61%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQD-GMKSNQEQNGVLHD 301 YCDYIYGTDKGYR+QKK+L+Q+++ KSNQ G+ +D Sbjct: 260 YCDYIYGTDKGYRFQKKLLEQIKESSKKSNQHSGGIKYD 298 >gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theobroma cacao] Length = 304 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNGVLHDISAQGHK 280 YCDYIYGTDKGYRY KKVL++L++ ++N QNG + + Q K Sbjct: 258 YCDYIYGTDKGYRYHKKVLRKLKEESRTNGAQNGGSYYVPTQDLK 302 >ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X1 [Citrus sinensis] gi|568846931|ref|XP_006477295.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X2 [Citrus sinensis] gi|568846933|ref|XP_006477296.1| PREDICTED: methylsterol monooxygenase 1-2-like [Citrus sinensis] Length = 300 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/34 (61%), Positives = 31/34 (91%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCD++YGTDKGYRYQKK+L+++Q+ ++ + EQNG Sbjct: 258 YCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNG 291 >ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citrus clementina] gi|557542684|gb|ESR53662.1| hypothetical protein CICLE_v10021364mg [Citrus clementina] Length = 300 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/34 (61%), Positives = 31/34 (91%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCD++YGTDKGYRYQKK+L+++Q+ ++ + EQNG Sbjct: 258 YCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNG 291 >ref|XP_004159506.1| PREDICTED: methylsterol monooxygenase 1-2-like [Cucumis sativus] Length = 300 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQE 322 YCDYIYGTDKGYRYQKK+LQ+L++ +K+++E Sbjct: 258 YCDYIYGTDKGYRYQKKILQKLKEEVKNSEE 288 >ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-like [Cicer arietinum] Length = 303 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYRYQKK+L++L++ + + QNG Sbjct: 258 YCDYIYGTDKGYRYQKKILRKLKEELTNGAAQNG 291 >ref|XP_006288336.1| hypothetical protein CARUB_v10001581mg [Capsella rubella] gi|482557042|gb|EOA21234.1| hypothetical protein CARUB_v10001581mg [Capsella rubella] Length = 298 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYR+QKK+L+Q+++ K + + NG Sbjct: 260 YCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >gb|AAQ13424.1|AF039199_1 sterol-4-methyl-oxidase [Arabidopsis thaliana] Length = 298 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYR+QKK+L+Q+++ K + + NG Sbjct: 260 YCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >gb|AAM64961.1| putative C-4 sterol methyl oxidase [Arabidopsis thaliana] Length = 298 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYR+QKK+L+Q+++ K + + NG Sbjct: 260 YCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >ref|NP_192948.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana] gi|75154239|sp|Q8L7W5.1|SMO11_ARATH RecName: Full=Methylsterol monooxygenase 1-1; AltName: Full=Sterol 4-alpha-methyl-oxidase 1-1; Short=AtSMO1-1 gi|21928127|gb|AAM78091.1| AT4g12110/F16J13_180 [Arabidopsis thaliana] gi|23308291|gb|AAN18115.1| At4g12110/F16J13_180 [Arabidopsis thaliana] gi|332657697|gb|AEE83097.1| sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana] Length = 298 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYR+QKK+L+Q+++ K + + NG Sbjct: 260 YCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293 >ref|XP_002872644.1| hypothetical protein ARALYDRAFT_911602 [Arabidopsis lyrata subsp. lyrata] gi|297318481|gb|EFH48903.1| hypothetical protein ARALYDRAFT_911602 [Arabidopsis lyrata subsp. lyrata] Length = 298 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKGYR+QKK+L+Q+++ K + NG Sbjct: 260 YCDYIYGTDKGYRFQKKLLEQIKESSKKGNKHNG 293 >gb|AFK37077.1| unknown [Medicago truncatula] Length = 303 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKG+RYQKK+LQ+L++ + QNG Sbjct: 258 YCDYIYGTDKGFRYQKKILQKLKEDSTNGAAQNG 291 >ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula] gi|355509852|gb|AES90994.1| Sterol-4-methyl-oxidase [Medicago truncatula] Length = 303 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -3 Query: 414 YCDYIYGTDKGYRYQKKVLQQLQDGMKSNQEQNG 313 YCDYIYGTDKG+RYQKK+LQ+L++ + QNG Sbjct: 258 YCDYIYGTDKGFRYQKKILQKLKEDSTNGAAQNG 291