BLASTX nr result
ID: Rehmannia26_contig00008099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00008099 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280187.1| PREDICTED: uncharacterized protein LOC100260... 60 3e-07 emb|CAN78613.1| hypothetical protein VITISV_028923 [Vitis vinifera] 56 6e-06 >ref|XP_002280187.1| PREDICTED: uncharacterized protein LOC100260337 [Vitis vinifera] gi|297745939|emb|CBI15995.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 2/52 (3%) Frame = -3 Query: 370 FELRDLIVDSDESSIRLRTFELQRPSGRPHGKIRLKLTLIER--PVDNYHTA 221 F ++DL VDSDES+ +RT EL+RPSGRP+GKIR+KL L ER P +YH A Sbjct: 107 FPIKDL-VDSDESANSIRTLELRRPSGRPNGKIRIKLALRERPPPTPDYHIA 157 >emb|CAN78613.1| hypothetical protein VITISV_028923 [Vitis vinifera] Length = 609 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -3 Query: 346 DSDESSIRLRTFELQRPSGRPHGKIRLKLTLIER--PVDNYHTA 221 DSDES+ +RT EL+RPSGRP+GKIR+KL L ER P +YH A Sbjct: 94 DSDESANSIRTLELRRPSGRPNGKIRIKLALRERPPPTPDYHIA 137