BLASTX nr result
ID: Rehmannia26_contig00007227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00007227 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC19483.1| 40S ribosomal protein S20-2 [Morus notabilis] gi|... 62 1e-07 emb|CAB89318.1| 40S ribsomomal protein [Arabidopsis thaliana] gi... 62 1e-07 ref|NP_190321.1| 40S ribosomal protein S20-2 [Arabidopsis thalia... 62 1e-07 ref|XP_006355268.1| PREDICTED: 40S ribosomal protein S20-2-like ... 62 1e-07 ref|XP_006347675.1| PREDICTED: 40S ribosomal protein S20-2-like ... 62 1e-07 ref|XP_006421732.1| hypothetical protein CICLE_v10006225mg [Citr... 62 1e-07 ref|XP_006404391.1| hypothetical protein EUTSA_v10010823mg [Eutr... 62 1e-07 ref|XP_006401962.1| hypothetical protein EUTSA_v10015032mg [Eutr... 62 1e-07 ref|XP_006394402.1| hypothetical protein EUTSA_v10005136mg [Eutr... 62 1e-07 gb|EOY22937.1| Ribosomal protein S10p/S20e family protein isofor... 62 1e-07 ref|XP_006291965.1| hypothetical protein CARUB_v10018153mg [Caps... 62 1e-07 ref|XP_006288907.1| hypothetical protein CARUB_v10002268mg [Caps... 62 1e-07 ref|XP_006281256.1| hypothetical protein CARUB_v10027301mg, part... 62 1e-07 gb|EMJ19809.1| hypothetical protein PRUPE_ppa013457mg [Prunus pe... 62 1e-07 gb|EMJ19807.1| hypothetical protein PRUPE_ppa013445mg [Prunus pe... 62 1e-07 gb|EMJ19806.1| hypothetical protein PRUPE_ppa013445mg [Prunus pe... 62 1e-07 ref|NP_201036.1| 40S ribosomal protein S20-1 [Arabidopsis thalia... 62 1e-07 ref|XP_002877555.1| 40S ribosomal protein S20 [Arabidopsis lyrat... 62 1e-07 ref|XP_002866483.1| 40S ribosomal protein S20 [Arabidopsis lyrat... 62 1e-07 ref|XP_002866482.1| 40S ribosomal protein S20 [Arabidopsis lyrat... 62 1e-07 >gb|EXC19483.1| 40S ribosomal protein S20-2 [Morus notabilis] gi|587932430|gb|EXC19484.1| 40S ribosomal protein S20-2 [Morus notabilis] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >emb|CAB89318.1| 40S ribsomomal protein [Arabidopsis thaliana] gi|8809643|dbj|BAA97194.1| 40S ribosomal protein S20 [Arabidopsis thaliana] gi|23198348|gb|AAN15701.1| 40S ribosomal protein S20 [Arabidopsis thaliana] Length = 117 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 87 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 117 >ref|NP_190321.1| 40S ribosomal protein S20-2 [Arabidopsis thaliana] gi|30692858|ref|NP_850665.1| 40S ribosomal protein S20-2 [Arabidopsis thaliana] gi|79314572|ref|NP_001030826.1| 40S ribosomal protein S20-2 [Arabidopsis thaliana] gi|75266342|sp|Q9STY6.1|RS202_ARATH RecName: Full=40S ribosomal protein S20-2 gi|5541704|emb|CAB51209.1| 40S RIBOSOMAL PROTEIN S20 homolog [Arabidopsis thaliana] gi|21617905|gb|AAM66955.1| 40S ribosomal protein S20-like protein [Arabidopsis thaliana] gi|27765022|gb|AAO23632.1| At3g47370 [Arabidopsis thaliana] gi|110743118|dbj|BAE99451.1| 40S ribosomal protein S20-like protein [Arabidopsis thaliana] gi|110743828|dbj|BAE99749.1| 40S ribosomal protein S20-like protein [Arabidopsis thaliana] gi|332644750|gb|AEE78271.1| 40S ribosomal protein S20-2 [Arabidopsis thaliana] gi|332644751|gb|AEE78272.1| 40S ribosomal protein S20-2 [Arabidopsis thaliana] gi|332644752|gb|AEE78273.1| 40S ribosomal protein S20-2 [Arabidopsis thaliana] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_006355268.1| PREDICTED: 40S ribosomal protein S20-2-like [Solanum tuberosum] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_006347675.1| PREDICTED: 40S ribosomal protein S20-2-like [Solanum tuberosum] Length = 123 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 93 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 123 >ref|XP_006421732.1| hypothetical protein CICLE_v10006225mg [Citrus clementina] gi|567858100|ref|XP_006421733.1| hypothetical protein CICLE_v10006225mg [Citrus clementina] gi|568885108|ref|XP_006495151.1| PREDICTED: 40S ribosomal protein S20-2-like isoform X1 [Citrus sinensis] gi|557523605|gb|ESR34972.1| hypothetical protein CICLE_v10006225mg [Citrus clementina] gi|557523606|gb|ESR34973.1| hypothetical protein CICLE_v10006225mg [Citrus clementina] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_006404391.1| hypothetical protein EUTSA_v10010823mg [Eutrema salsugineum] gi|567189431|ref|XP_006404392.1| hypothetical protein EUTSA_v10010823mg [Eutrema salsugineum] gi|557105510|gb|ESQ45844.1| hypothetical protein EUTSA_v10010823mg [Eutrema salsugineum] gi|557105511|gb|ESQ45845.1| hypothetical protein EUTSA_v10010823mg [Eutrema salsugineum] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_006401962.1| hypothetical protein EUTSA_v10015032mg [Eutrema salsugineum] gi|567180726|ref|XP_006401963.1| hypothetical protein EUTSA_v10015032mg [Eutrema salsugineum] gi|557103052|gb|ESQ43415.1| hypothetical protein EUTSA_v10015032mg [Eutrema salsugineum] gi|557103053|gb|ESQ43416.1| hypothetical protein EUTSA_v10015032mg [Eutrema salsugineum] Length = 123 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 93 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 123 >ref|XP_006394402.1| hypothetical protein EUTSA_v10005136mg [Eutrema salsugineum] gi|557091041|gb|ESQ31688.1| hypothetical protein EUTSA_v10005136mg [Eutrema salsugineum] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >gb|EOY22937.1| Ribosomal protein S10p/S20e family protein isoform 1 [Theobroma cacao] gi|508775682|gb|EOY22938.1| Ribosomal protein S10p/S20e family protein isoform 1 [Theobroma cacao] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_006291965.1| hypothetical protein CARUB_v10018153mg [Capsella rubella] gi|482560672|gb|EOA24863.1| hypothetical protein CARUB_v10018153mg [Capsella rubella] Length = 161 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 131 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 161 >ref|XP_006288907.1| hypothetical protein CARUB_v10002268mg [Capsella rubella] gi|482557613|gb|EOA21805.1| hypothetical protein CARUB_v10002268mg [Capsella rubella] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_006281256.1| hypothetical protein CARUB_v10027301mg, partial [Capsella rubella] gi|482549960|gb|EOA14154.1| hypothetical protein CARUB_v10027301mg, partial [Capsella rubella] Length = 152 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 122 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 152 >gb|EMJ19809.1| hypothetical protein PRUPE_ppa013457mg [Prunus persica] Length = 121 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 91 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >gb|EMJ19807.1| hypothetical protein PRUPE_ppa013445mg [Prunus persica] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >gb|EMJ19806.1| hypothetical protein PRUPE_ppa013445mg [Prunus persica] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|NP_201036.1| 40S ribosomal protein S20-1 [Arabidopsis thaliana] gi|22331606|ref|NP_190089.2| 40S ribosomal protein S20-1 [Arabidopsis thaliana] gi|145334871|ref|NP_001078781.1| 40S ribosomal protein S20-1 [Arabidopsis thaliana] gi|21542443|sp|P49200.2|RS201_ARATH RecName: Full=40S ribosomal protein S20-1 gi|11762182|gb|AAG40369.1|AF325017_1 AT5g62300 [Arabidopsis thaliana] gi|13877519|gb|AAK43837.1|AF370460_1 40S ribosomal protein S20 [Arabidopsis thaliana] gi|20465624|gb|AAM20143.1| putative 40S ribsomomal protein [Arabidopsis thaliana] gi|21281054|gb|AAM45072.1| putative 40S ribsomomal protein [Arabidopsis thaliana] gi|21553799|gb|AAM62892.1| ribosomal protein S20-like protein [Arabidopsis thaliana] gi|332010210|gb|AED97593.1| 40S ribosomal protein S20-1 [Arabidopsis thaliana] gi|332010211|gb|AED97594.1| 40S ribosomal protein S20-1 [Arabidopsis thaliana] gi|332644460|gb|AEE77981.1| 40S ribosomal protein S20-1 [Arabidopsis thaliana] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 94 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >ref|XP_002877555.1| 40S ribosomal protein S20 [Arabidopsis lyrata subsp. lyrata] gi|297323393|gb|EFH53814.1| 40S ribosomal protein S20 [Arabidopsis lyrata subsp. lyrata] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 92 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_002866483.1| 40S ribosomal protein S20 [Arabidopsis lyrata subsp. lyrata] gi|297312318|gb|EFH42742.1| 40S ribosomal protein S20 [Arabidopsis lyrata subsp. lyrata] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 94 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 124 >ref|XP_002866482.1| 40S ribosomal protein S20 [Arabidopsis lyrata subsp. lyrata] gi|297312317|gb|EFH42741.1| 40S ribosomal protein S20 [Arabidopsis lyrata subsp. lyrata] Length = 123 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 95 IDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 93 IDLFSSPDVVKQITSITIEPGVEVEVTIADS 123