BLASTX nr result
ID: Rehmannia26_contig00006922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00006922 (711 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU16136.1| unknown [Glycine max] 57 4e-06 >gb|ACU16136.1| unknown [Glycine max] Length = 161 Score = 57.4 bits (137), Expect = 4e-06 Identities = 44/106 (41%), Positives = 52/106 (49%), Gaps = 14/106 (13%) Frame = -2 Query: 428 SFIRSTHPGGNSNKEQPNILP*NRRYRWIVVEEAVADRIGGRTAADIPGVG--------- 276 S +RSTHP +S++ QPN LP N + R V+ A A+RI R A D P G Sbjct: 40 SHLRSTHPKDSSSRGQPNSLP-NNQGRLNFVDGAEAERIEERRAEDTPAPGRAAEDSLVA 98 Query: 275 ---SPVGIPAAGNPAADKHPSGNPPAGNLG--EEAHQRGVDSDCNN 153 VGIPAAG A D P PPA NL E V + CNN Sbjct: 99 ADIPAVGIPAAGILAVDSLPFRTPPAYNLAAVELRLAAVVAAGCNN 144