BLASTX nr result
ID: Rehmannia26_contig00004925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00004925 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349692.1| PREDICTED: uncharacterized protein LOC102591... 56 4e-06 >ref|XP_006349692.1| PREDICTED: uncharacterized protein LOC102591801 [Solanum tuberosum] Length = 162 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = +3 Query: 240 MKVHPVPRKRNNTLRYDVASVLAQAN--SCRQKKLRR 344 MKVHPVPRKRN TLRYD+ S L+QAN S RQKKLRR Sbjct: 1 MKVHPVPRKRNITLRYDIVSALSQANALSGRQKKLRR 37