BLASTX nr result
ID: Rehmannia26_contig00004901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00004901 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004249679.1| PREDICTED: protein LURP-one-related 15-like ... 60 2e-07 ref|XP_002323041.2| hypothetical protein POPTR_0016s13840g [Popu... 59 5e-07 ref|XP_006387427.1| hypothetical protein POPTR_1048s00200g [Popu... 59 9e-07 ref|XP_002323049.1| predicted protein [Populus trichocarpa] 59 9e-07 ref|XP_002323653.2| hypothetical protein POPTR_0016s13920g, part... 58 1e-06 emb|CBW47299.1| tubby structurally-related protein [Carica papaya] 58 1e-06 ref|XP_002323048.2| hypothetical protein POPTR_0016s13930g [Popu... 58 1e-06 ref|XP_006338963.1| PREDICTED: protein LURP-one-related 15-like ... 56 4e-06 ref|XP_002533823.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_004302604.1| PREDICTED: protein LURP-one-related 15-like ... 55 1e-05 >ref|XP_004249679.1| PREDICTED: protein LURP-one-related 15-like [Solanum lycopersicum] Length = 214 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 + F VTVYPNVDYAF+V+L+V+LEEINEDRSG D Sbjct: 181 DNFGVTVYPNVDYAFIVALVVILEEINEDRSGSD 214 >ref|XP_002323041.2| hypothetical protein POPTR_0016s13840g [Populus trichocarpa] gi|550321465|gb|EEF04802.2| hypothetical protein POPTR_0016s13840g [Populus trichocarpa] Length = 216 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 ++F VTVYPNVDYAF+V+L+V+L+EIN DRSGED Sbjct: 183 DSFGVTVYPNVDYAFIVALVVILDEINADRSGED 216 >ref|XP_006387427.1| hypothetical protein POPTR_1048s00200g [Populus trichocarpa] gi|550307063|gb|ERP46341.1| hypothetical protein POPTR_1048s00200g [Populus trichocarpa] Length = 216 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 + F VTVYPNVDYAF+V+L+V+L+EIN DRSGED Sbjct: 183 DRFGVTVYPNVDYAFIVALVVILDEINADRSGED 216 >ref|XP_002323049.1| predicted protein [Populus trichocarpa] Length = 216 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 + F VTVYPNVDYAF+V+L+V+L+EIN DRSGED Sbjct: 183 DRFGVTVYPNVDYAFIVALVVILDEINADRSGED 216 >ref|XP_002323653.2| hypothetical protein POPTR_0016s13920g, partial [Populus trichocarpa] gi|550321469|gb|EEF05414.2| hypothetical protein POPTR_0016s13920g, partial [Populus trichocarpa] Length = 186 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 ++F VTVYPNVDYAF+V+++V+L+EIN DRSGED Sbjct: 153 DSFGVTVYPNVDYAFIVAVVVILDEINADRSGED 186 >emb|CBW47299.1| tubby structurally-related protein [Carica papaya] Length = 210 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 33/34 (97%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 ++FAVTVYP+VDYAF+V+L+++L EINEDRSG+D Sbjct: 177 DSFAVTVYPHVDYAFIVALVIILYEINEDRSGDD 210 >ref|XP_002323048.2| hypothetical protein POPTR_0016s13930g [Populus trichocarpa] gi|550321470|gb|EEF04809.2| hypothetical protein POPTR_0016s13930g [Populus trichocarpa] Length = 216 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 ++F VTVYPNVDYAF+ +L+V+L+EIN DRSGED Sbjct: 183 DSFGVTVYPNVDYAFIAALVVILDEINADRSGED 216 >ref|XP_006338963.1| PREDICTED: protein LURP-one-related 15-like [Solanum tuberosum] Length = 212 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRS 253 + F VTVYPNVDYAFVV+L+V+LEEINEDRS Sbjct: 181 DNFGVTVYPNVDYAFVVALVVILEEINEDRS 211 >ref|XP_002533823.1| conserved hypothetical protein [Ricinus communis] gi|223526240|gb|EEF28558.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 + F VTVYPNVDYAF+ +L+V+L+EINEDR G+D Sbjct: 180 DNFEVTVYPNVDYAFIAALVVVLDEINEDRRGDD 213 >ref|XP_004302604.1| PREDICTED: protein LURP-one-related 15-like [Fragaria vesca subsp. vesca] Length = 213 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 345 ETFAVTVYPNVDYAFVVSLIVLLEEINEDRSGED 244 + FAVTVYP+VDYAF+V+++V+L EIN DRSG+D Sbjct: 180 DAFAVTVYPHVDYAFIVAIVVVLHEINMDRSGQD 213