BLASTX nr result
ID: Rehmannia26_contig00002612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00002612 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299187.2| hypothetical protein POPTR_0001s06910g [Popu... 60 2e-07 gb|EXB62668.1| hypothetical protein L484_023964 [Morus notabilis] 57 3e-06 ref|XP_002303944.1| hypothetical protein POPTR_0003s19320g [Popu... 57 3e-06 >ref|XP_002299187.2| hypothetical protein POPTR_0001s06910g [Populus trichocarpa] gi|550346699|gb|EEE83992.2| hypothetical protein POPTR_0001s06910g [Populus trichocarpa] Length = 392 Score = 60.5 bits (145), Expect = 2e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSW 217 MEWYSGS ++D VP + E+YDRLPSP+SWS W Sbjct: 1 MEWYSGSGIDDFVVPEDREVYDRLPSPESWSKW 33 >gb|EXB62668.1| hypothetical protein L484_023964 [Morus notabilis] Length = 452 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 6/82 (7%) Frame = +2 Query: 116 LMEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWG-KIMNSSKKLNMLG---MEECPLRE 283 LM+WYS + ++DL VP + + DRLPSPDSWS WG +M S N G ++ E Sbjct: 42 LMDWYSANGIDDLIVPKDGGLSDRLPSPDSWSKWGVGVMESYPSHNKGGSAFRQKFTAEE 101 Query: 284 TMFSS--GDVEQRDCQRSRHAS 343 F S DVE D H+S Sbjct: 102 PDFRSLYDDVEMEDFVDKCHSS 123 >ref|XP_002303944.1| hypothetical protein POPTR_0003s19320g [Populus trichocarpa] gi|222841376|gb|EEE78923.1| hypothetical protein POPTR_0003s19320g [Populus trichocarpa] Length = 427 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSW 217 MEWYS ++D VP ++E+YDRLPSP+SWS W Sbjct: 1 MEWYSDDCIDDFEVPKDQEVYDRLPSPESWSKW 33