BLASTX nr result
ID: Rehmannia26_contig00001034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00001034 (973 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 41 5e-06 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +2 Query: 275 RMTCTLWKDYVDTILPYLEEHSLEPVVIVIQLCRAKV 385 ++ CT+W D+V + P+ + +PV+I++Q CR KV Sbjct: 176 QIKCTVWDDHVSKLEPFYQSTKQDPVIILLQFCRVKV 212 Score = 37.0 bits (84), Expect(2) = 5e-06 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +3 Query: 78 LTDIIGRVVPMQSAQTKDFAGKTTSFIDIILEDLE 182 L D+IG VV + + Q K AGK T ID +LED E Sbjct: 139 LIDLIGMVVEINTPQDKVIAGKATRLIDFLLEDTE 173