BLASTX nr result
ID: Rehmannia26_contig00000987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00000987 (462 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366880.1| PREDICTED: TOM1-like protein 2-like [Solanum... 57 3e-06 ref|XP_004246315.1| PREDICTED: uncharacterized protein LOC101245... 55 7e-06 >ref|XP_006366880.1| PREDICTED: TOM1-like protein 2-like [Solanum tuberosum] Length = 720 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Frame = -3 Query: 112 RPSSSQPQFSAYPPPPWAATPGYYSN----QRPAYTYSAPR 2 R + PQ+SAYPPPPWAATPGY SN RP Y YS P+ Sbjct: 588 RAQTQFPQYSAYPPPPWAATPGYLSNPSPSSRPTYMYSTPQ 628 >ref|XP_004246315.1| PREDICTED: uncharacterized protein LOC101245875 [Solanum lycopersicum] Length = 705 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/39 (61%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -3 Query: 112 RPSSSQPQFSAYPPPPWAATPGYYSN--QRPAYTYSAPR 2 R + PQ+SAYPPPPWAATPGY SN RP Y Y P+ Sbjct: 576 RTQTQFPQYSAYPPPPWAATPGYLSNTTSRPTYMYPTPQ 614