BLASTX nr result
ID: Rehmannia26_contig00000887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00000887 (965 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355521.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 97 9e-18 ref|XP_004245751.1| PREDICTED: uncharacterized protein LOC101251... 97 9e-18 ref|XP_006391857.1| hypothetical protein EUTSA_v10023531mg [Eutr... 94 1e-16 ref|XP_004298649.1| PREDICTED: uncharacterized protein LOC101311... 91 5e-16 ref|XP_006385727.1| hypothetical protein POPTR_0003s11060g [Popu... 90 1e-15 ref|XP_003525816.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 89 2e-15 ref|XP_006477233.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 88 4e-15 ref|XP_006440348.1| hypothetical protein CICLE_v10021835mg [Citr... 88 4e-15 gb|EPS72593.1| hypothetical protein M569_02163, partial [Genlise... 88 4e-15 ref|NP_176439.1| bifunctional inhibitor/lipid-transfer protein/s... 87 7e-15 ref|XP_002271658.2| PREDICTED: uncharacterized protein LOC100262... 86 2e-14 emb|CBI31905.3| unnamed protein product [Vitis vinifera] 86 2e-14 emb|CAN80711.1| hypothetical protein VITISV_033378 [Vitis vinifera] 86 2e-14 ref|XP_003608742.1| Proline rich protein [Medicago truncatula] g... 86 2e-14 gb|EMJ12317.1| hypothetical protein PRUPE_ppa025269mg [Prunus pe... 86 3e-14 ref|XP_002303511.1| predicted protein [Populus trichocarpa] 86 3e-14 ref|XP_003549908.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 85 4e-14 gb|ESW27636.1| hypothetical protein PHAVU_003G219000g [Phaseolus... 85 5e-14 ref|XP_006301895.1| hypothetical protein CARUB_v10022370mg [Caps... 84 6e-14 ref|XP_004169261.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 84 8e-14 >ref|XP_006355521.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Solanum tuberosum] Length = 231 Score = 97.1 bits (240), Expect = 9e-18 Identities = 45/61 (73%), Positives = 47/61 (77%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+E+ICCPVLQGLLELEAAICLCTTIR SVLATCGLTPPPGFVCPP Sbjct: 170 NPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFVCPP 229 Query: 798 L 800 L Sbjct: 230 L 230 >ref|XP_004245751.1| PREDICTED: uncharacterized protein LOC101251115 [Solanum lycopersicum] Length = 292 Score = 97.1 bits (240), Expect = 9e-18 Identities = 45/61 (73%), Positives = 47/61 (77%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+E+ICCPVLQGLLELEAAICLCTTIR SVLATCGLTPPPGFVCPP Sbjct: 231 NPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFLPLALSVLATCGLTPPPGFVCPP 290 Query: 798 L 800 L Sbjct: 291 L 291 >ref|XP_006391857.1| hypothetical protein EUTSA_v10023531mg [Eutrema salsugineum] gi|557088363|gb|ESQ29143.1| hypothetical protein EUTSA_v10023531mg [Eutrema salsugineum] Length = 373 Score = 93.6 bits (231), Expect = 1e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPVLQGLLELEAAICLCTTIR L TCGLTPPPGFVCPP Sbjct: 312 NPVENVCCPVLQGLLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGLTPPPGFVCPP 371 Query: 798 L 800 L Sbjct: 372 L 372 >ref|XP_004298649.1| PREDICTED: uncharacterized protein LOC101311476 [Fragaria vesca subsp. vesca] Length = 226 Score = 91.3 bits (225), Expect = 5e-16 Identities = 41/61 (67%), Positives = 43/61 (70%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN CCPVLQGLLELEAAICLCTTIR L TCG+TPPPGFVCPP Sbjct: 166 NPVENACCPVLQGLLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGITPPPGFVCPP 225 Query: 798 L 800 L Sbjct: 226 L 226 >ref|XP_006385727.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa] gi|550342944|gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa] Length = 234 Score = 89.7 bits (221), Expect = 1e-15 Identities = 40/61 (65%), Positives = 44/61 (72%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPVL+GLLELEAAICLCT+IR VL TCG TPPPGFVCPP Sbjct: 174 NPVENVCCPVLKGLLELEAAICLCTSIRLKLLNLTIFIPLALQVLITCGQTPPPGFVCPP 233 Query: 798 L 800 L Sbjct: 234 L 234 >ref|XP_003525816.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max] Length = 179 Score = 89.4 bits (220), Expect = 2e-15 Identities = 39/61 (63%), Positives = 43/61 (70%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPV+QGLL+LEAAICLCT IR VL TCG TPPPGFVCPP Sbjct: 118 NPVENVCCPVIQGLLDLEAAICLCTVIRAKLLNLSIFLPIALQVLVTCGKTPPPGFVCPP 177 Query: 798 L 800 L Sbjct: 178 L 178 >ref|XP_006477233.1| PREDICTED: 36.4 kDa proline-rich protein-like [Citrus sinensis] Length = 240 Score = 88.2 bits (217), Expect = 4e-15 Identities = 40/61 (65%), Positives = 42/61 (68%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN CCPVL+GLLELEAAICLCTTIR L TCG TPPPGFVCPP Sbjct: 180 NPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKTPPPGFVCPP 239 Query: 798 L 800 L Sbjct: 240 L 240 >ref|XP_006440348.1| hypothetical protein CICLE_v10021835mg [Citrus clementina] gi|557542610|gb|ESR53588.1| hypothetical protein CICLE_v10021835mg [Citrus clementina] Length = 252 Score = 88.2 bits (217), Expect = 4e-15 Identities = 40/61 (65%), Positives = 42/61 (68%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN CCPVL+GLLELEAAICLCTTIR L TCG TPPPGFVCPP Sbjct: 192 NPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIPLALQALITCGKTPPPGFVCPP 251 Query: 798 L 800 L Sbjct: 252 L 252 >gb|EPS72593.1| hypothetical protein M569_02163, partial [Genlisea aurea] Length = 152 Score = 88.2 bits (217), Expect = 4e-15 Identities = 39/61 (63%), Positives = 43/61 (70%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPV+ GLLE+EAAICLCTTIR VL TCGL PPPGFVCPP Sbjct: 92 NPVENMCCPVIGGLLEVEAAICLCTTIRLRLLNVNVFLPLALQVLVTCGLNPPPGFVCPP 151 Query: 798 L 800 L Sbjct: 152 L 152 >ref|NP_176439.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] gi|5454192|gb|AAD43607.1|AC005698_6 T3P18.6 [Arabidopsis thaliana] gi|15028319|gb|AAK76636.1| putative proline-rich cell wall protein [Arabidopsis thaliana] gi|19310693|gb|AAL85077.1| putative proline-rich cell wall protein [Arabidopsis thaliana] gi|21593172|gb|AAM65121.1| putative proline-rich cell wall protein [Arabidopsis thaliana] gi|332195851|gb|AEE33972.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] Length = 297 Score = 87.4 bits (215), Expect = 7e-15 Identities = 38/61 (62%), Positives = 42/61 (68%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPVLQGLLELEAA+CLCTTIR L TCG+ PP GFVCPP Sbjct: 236 NPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFIPLALQALITCGINPPSGFVCPP 295 Query: 798 L 800 L Sbjct: 296 L 296 >ref|XP_002271658.2| PREDICTED: uncharacterized protein LOC100262648 [Vitis vinifera] Length = 236 Score = 86.3 bits (212), Expect = 2e-14 Identities = 38/61 (62%), Positives = 41/61 (67%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPVL GLLELEAA+CLCT IR L TCG TPPPGFVCPP Sbjct: 176 NPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIPIALEALITCGKTPPPGFVCPP 235 Query: 798 L 800 L Sbjct: 236 L 236 >emb|CBI31905.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 86.3 bits (212), Expect = 2e-14 Identities = 38/61 (62%), Positives = 41/61 (67%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPVL GLLELEAA+CLCT IR L TCG TPPPGFVCPP Sbjct: 96 NPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIPIALEALITCGKTPPPGFVCPP 155 Query: 798 L 800 L Sbjct: 156 L 156 >emb|CAN80711.1| hypothetical protein VITISV_033378 [Vitis vinifera] Length = 261 Score = 86.3 bits (212), Expect = 2e-14 Identities = 38/61 (62%), Positives = 41/61 (67%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPVL GLLELEAA+CLCT IR L TCG TPPPGFVCPP Sbjct: 176 NPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFIPIALEALITCGKTPPPGFVCPP 235 Query: 798 L 800 L Sbjct: 236 L 236 >ref|XP_003608742.1| Proline rich protein [Medicago truncatula] gi|355509797|gb|AES90939.1| Proline rich protein [Medicago truncatula] Length = 189 Score = 85.9 bits (211), Expect = 2e-14 Identities = 37/61 (60%), Positives = 43/61 (70%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP++N+CCPV+QGL++LEAAICLCT IR VL TCG TPPPGFVCPP Sbjct: 129 NPLKNVCCPVIQGLVDLEAAICLCTAIRAKVLNLNIFLPLALQVLITCGKTPPPGFVCPP 188 Query: 798 L 800 L Sbjct: 189 L 189 >gb|EMJ12317.1| hypothetical protein PRUPE_ppa025269mg [Prunus persica] Length = 262 Score = 85.5 bits (210), Expect = 3e-14 Identities = 38/61 (62%), Positives = 41/61 (67%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN CCP+L GLLELEAAICLCTTI+ L TCG TPPPGFVCPP Sbjct: 202 NPVENACCPILGGLLELEAAICLCTTIKLKLLNLNIFIPLALQALITCGKTPPPGFVCPP 261 Query: 798 L 800 L Sbjct: 262 L 262 >ref|XP_002303511.1| predicted protein [Populus trichocarpa] Length = 104 Score = 85.5 bits (210), Expect = 3e-14 Identities = 38/59 (64%), Positives = 42/59 (71%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCP 794 NP+EN+CCPVL+GLLELEAAICLCT+IR VL TCG TPPPGFVCP Sbjct: 46 NPVENVCCPVLKGLLELEAAICLCTSIRLKLLNLTIFIPLALQVLITCGQTPPPGFVCP 104 >ref|XP_003549908.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max] Length = 178 Score = 85.1 bits (209), Expect = 4e-14 Identities = 37/61 (60%), Positives = 42/61 (68%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN+CCPV+QGLL+LEAAICLCT IR +L TCG T PPGFVCPP Sbjct: 117 NPVENVCCPVIQGLLDLEAAICLCTVIRAKLLNLNIFLPLALQLLVTCGKTAPPGFVCPP 176 Query: 798 L 800 L Sbjct: 177 L 177 >gb|ESW27636.1| hypothetical protein PHAVU_003G219000g [Phaseolus vulgaris] Length = 171 Score = 84.7 bits (208), Expect = 5e-14 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = +3 Query: 621 PIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPPL 800 P+EN+CCP +QGLL+LEAAICLCT IR VL TCG TPPPGFVCPPL Sbjct: 111 PVENVCCPFIQGLLDLEAAICLCTVIRAKVLKLNIFLPIALQVLITCGKTPPPGFVCPPL 170 >ref|XP_006301895.1| hypothetical protein CARUB_v10022370mg [Capsella rubella] gi|482570605|gb|EOA34793.1| hypothetical protein CARUB_v10022370mg [Capsella rubella] Length = 307 Score = 84.3 bits (207), Expect = 6e-14 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = +3 Query: 621 PIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPPL 800 P+EN+CCPVLQGLLE+EAA+CLCTTIR L TCG+ PP GFVCPPL Sbjct: 247 PVENVCCPVLQGLLEIEAAVCLCTTIRLKLLNLNIFIPLALQALITCGINPPSGFVCPPL 306 >ref|XP_004169261.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis sativus] Length = 136 Score = 84.0 bits (206), Expect = 8e-14 Identities = 37/61 (60%), Positives = 40/61 (65%) Frame = +3 Query: 618 NPIENICCPVLQGLLELEAAICLCTTIRXXXXXXXXXXXXXXSVLATCGLTPPPGFVCPP 797 NP+EN CCPVL GLLELEAA+CLCTT+R L TCG PPPGFVCPP Sbjct: 76 NPVENACCPVLGGLLELEAAVCLCTTLRIKLLNLNIFIPLALQALITCGKNPPPGFVCPP 135 Query: 798 L 800 L Sbjct: 136 L 136