BLASTX nr result
ID: Rehmannia26_contig00000780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00000780 (501 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320762.1| peroxisomal biogenesis factor 11 family prot... 53 4e-11 ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C-... 55 8e-11 ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11C-... 55 8e-11 gb|EOX96084.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|508704... 55 1e-10 gb|AFK46771.1| unknown [Lotus japonicus] 55 2e-10 ref|XP_002301325.1| peroxisomal biogenesis factor 11 family prot... 53 5e-10 ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Popu... 53 5e-10 ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-... 55 7e-10 ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ric... 55 9e-10 gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis] 54 1e-09 gb|ESW11939.1| hypothetical protein PHAVU_008G071800g [Phaseolus... 52 1e-09 ref|NP_001235755.1| peroxisomal biogenesis factor 11 family prot... 52 2e-09 ref|XP_006586626.1| PREDICTED: uncharacterized protein LOC100499... 52 3e-09 ref|NP_001235577.1| uncharacterized protein LOC100499755 [Glycin... 52 3e-09 ref|XP_002889352.1| peroxisomal biogenesis factor 11 family prot... 54 3e-09 ref|NP_001234463.1| uncharacterized protein LOC543655 [Solanum l... 55 6e-09 ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C ... 49 7e-09 ref|XP_004964390.1| PREDICTED: peroxisomal membrane protein 11-5... 52 1e-08 gb|EMJ19501.1| hypothetical protein PRUPE_ppa010803mg [Prunus pe... 50 2e-08 ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citr... 51 2e-08 >ref|XP_002320762.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|566203052|ref|XP_006375324.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] gi|118489542|gb|ABK96573.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861535|gb|EEE99077.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|550323695|gb|ERP53121.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] Length = 235 Score = 52.8 bits (125), Expect(2) = 4e-11 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL+KSNER+LALVK+ MDIVVAVGLLQ Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQ 199 Score = 40.4 bits (93), Expect(2) = 4e-11 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLPSPQK+KTT Sbjct: 217 SSLISCYQLLPSPQKSKTT 235 >ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X1 [Solanum tuberosum] gi|565344758|ref|XP_006339471.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X2 [Solanum tuberosum] Length = 235 Score = 55.5 bits (132), Expect(2) = 8e-11 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KLQKSNER+LAL+KAG+DIVVAVGLLQ Sbjct: 169 QYRIKLQKSNERSLALIKAGIDIVVAVGLLQ 199 Score = 36.6 bits (83), Expect(2) = 8e-11 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLP+P KAKT+ Sbjct: 217 SSLISCYQLLPAPPKAKTS 235 >ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11C-like isoform 1 [Solanum lycopersicum] gi|460367976|ref|XP_004229846.1| PREDICTED: peroxisomal membrane protein 11C-like isoform 2 [Solanum lycopersicum] Length = 235 Score = 55.5 bits (132), Expect(2) = 8e-11 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KLQKSNER+LAL+KAG+DIVVAVGLLQ Sbjct: 169 QYRIKLQKSNERSLALIKAGIDIVVAVGLLQ 199 Score = 36.6 bits (83), Expect(2) = 8e-11 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLP+P KAKT+ Sbjct: 217 SSLISCYQLLPAPPKAKTS 235 >gb|EOX96084.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|508704189|gb|EOX96085.1| Peroxin 11c isoform 1 [Theobroma cacao] Length = 235 Score = 55.1 bits (131), Expect(2) = 1e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 +Y KLQKSNERTLALVKAGMDIVVAVGLLQ Sbjct: 169 EYCAKLQKSNERTLALVKAGMDIVVAVGLLQ 199 Score = 36.2 bits (82), Expect(2) = 1e-10 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 SSLISCYQLLPSP K+KT Sbjct: 217 SSLISCYQLLPSPPKSKT 234 >gb|AFK46771.1| unknown [Lotus japonicus] Length = 235 Score = 55.5 bits (132), Expect(2) = 2e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KLQKSNERTLALVKA +DIVVAVGLLQ Sbjct: 169 QYRAKLQKSNERTLALVKASIDIVVAVGLLQ 199 Score = 35.0 bits (79), Expect(2) = 2e-10 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLP+P K+KT+ Sbjct: 217 SSLISCYQLLPAPVKSKTS 235 >ref|XP_002301325.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|118484040|gb|ABK93906.1| unknown [Populus trichocarpa] gi|222843051|gb|EEE80598.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] Length = 235 Score = 52.8 bits (125), Expect(2) = 5e-10 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL+KSNER+LALVK+ MDIVVAVGLLQ Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQ 199 Score = 36.6 bits (83), Expect(2) = 5e-10 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 +SLISCYQLLPSPQK KT Sbjct: 217 TSLISCYQLLPSPQKPKT 234 >ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] gi|550345090|gb|ERP64387.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] Length = 180 Score = 52.8 bits (125), Expect(2) = 5e-10 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL+KSNER+LALVK+ MDIVVAVGLLQ Sbjct: 114 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQ 144 Score = 36.6 bits (83), Expect(2) = 5e-10 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 +SLISCYQLLPSPQK KT Sbjct: 162 TSLISCYQLLPSPQKPKT 179 >ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-like [Solanum tuberosum] Length = 235 Score = 55.5 bits (132), Expect(2) = 7e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR+KLQKSNER+LAL+KAG DIVVAVGLLQ Sbjct: 169 QYRSKLQKSNERSLALIKAGTDIVVAVGLLQ 199 Score = 33.5 bits (75), Expect(2) = 7e-10 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLPSP K K + Sbjct: 217 SSLISCYQLLPSPPKDKAS 235 >ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ricinus communis] gi|223548975|gb|EEF50464.1| peroxisomal biogenesis factor, putative [Ricinus communis] Length = 235 Score = 55.5 bits (132), Expect(2) = 9e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KLQKSNER+LALVKA MDIVVAVGLLQ Sbjct: 169 QYRAKLQKSNERSLALVKAAMDIVVAVGLLQ 199 Score = 33.1 bits (74), Expect(2) = 9e-10 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 +SLISCYQLLPS KAKT Sbjct: 217 TSLISCYQLLPSQPKAKT 234 >gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis] Length = 235 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL+KSNERTLAL+KA +DIVVAVGLLQ Sbjct: 169 QYRAKLKKSNERTLALIKASVDIVVAVGLLQ 199 Score = 34.7 bits (78), Expect(2) = 1e-09 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 SSLISCYQLLPSP K+K+ Sbjct: 217 SSLISCYQLLPSPPKSKS 234 >gb|ESW11939.1| hypothetical protein PHAVU_008G071800g [Phaseolus vulgaris] Length = 235 Score = 52.4 bits (124), Expect(2) = 1e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL KSNERTL+L+KAG+D+VVAVGLLQ Sbjct: 169 QYRGKLNKSNERTLSLIKAGIDMVVAVGLLQ 199 Score = 35.4 bits (80), Expect(2) = 1e-09 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLP+P K+KT+ Sbjct: 217 SSLISCYQLLPAPAKSKTS 235 >ref|NP_001235755.1| peroxisomal biogenesis factor 11 family protein [Glycine max] gi|571541257|ref|XP_006601716.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform X1 [Glycine max] gi|571541260|ref|XP_006601717.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform X2 [Glycine max] gi|571541264|ref|XP_006601718.1| PREDICTED: peroxisomal biogenesis factor 11 family protein isoform X3 [Glycine max] gi|218117595|dbj|BAH03205.1| peroxisomal biogenesis factor 11 family protein [Glycine max] gi|255632590|gb|ACU16645.1| unknown [Glycine max] Length = 235 Score = 52.4 bits (124), Expect(2) = 2e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL KSNERTL+L+KAG+D VVAVGLLQ Sbjct: 169 QYRAKLNKSNERTLSLIKAGIDTVVAVGLLQ 199 Score = 35.0 bits (79), Expect(2) = 2e-09 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 SSLISCYQLLP+P K+KT Sbjct: 217 SSLISCYQLLPAPAKSKT 234 >ref|XP_006586626.1| PREDICTED: uncharacterized protein LOC100499755 isoform X1 [Glycine max] Length = 235 Score = 52.4 bits (124), Expect(2) = 3e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL KSNERTL+L+KAG+D VVAVGLLQ Sbjct: 169 QYRAKLNKSNERTLSLIKAGIDTVVAVGLLQ 199 Score = 34.7 bits (78), Expect(2) = 3e-09 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 SSLISCYQLLP+P K+KT Sbjct: 217 SSLISCYQLLPAPVKSKT 234 >ref|NP_001235577.1| uncharacterized protein LOC100499755 [Glycine max] gi|255626311|gb|ACU13500.1| unknown [Glycine max] Length = 235 Score = 52.4 bits (124), Expect(2) = 3e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL KSNERTL+L+KAG+D VVAVGLLQ Sbjct: 169 QYRAKLNKSNERTLSLIKAGIDTVVAVGLLQ 199 Score = 34.7 bits (78), Expect(2) = 3e-09 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 SSLISCYQLLP+P K+KT Sbjct: 217 SSLISCYQLLPAPVKSKT 234 >ref|XP_002889352.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335194|gb|EFH65611.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] Length = 235 Score = 53.9 bits (128), Expect(2) = 3e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL+KSNER+LAL+KAGMD+VVA GLLQ Sbjct: 169 QYRAKLEKSNERSLALIKAGMDVVVAFGLLQ 199 Score = 32.7 bits (73), Expect(2) = 3e-09 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 SSLISCYQLLPS K+KT Sbjct: 217 SSLISCYQLLPSHPKSKT 234 >ref|NP_001234463.1| uncharacterized protein LOC543655 [Solanum lycopersicum] gi|8489788|gb|AAF75750.1|AF261140_1 unknown [Solanum lycopersicum] Length = 235 Score = 55.5 bits (132), Expect(2) = 6e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR+KLQKSNER+LAL+KAG DIVVAVGLLQ Sbjct: 169 QYRSKLQKSNERSLALIKAGTDIVVAVGLLQ 199 Score = 30.4 bits (67), Expect(2) = 6e-09 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLPS K K + Sbjct: 217 SSLISCYQLLPSSPKDKAS 235 >ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C isoform 2 [Vitis vinifera] gi|225453746|ref|XP_002273544.1| PREDICTED: peroxisomal membrane protein 11C isoform 1 [Vitis vinifera] gi|296089071|emb|CBI38774.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 48.9 bits (115), Expect(2) = 7e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR+KL+KSN R+LALVKA MD VVAVGLLQ Sbjct: 169 QYRSKLKKSNARSLALVKAVMDTVVAVGLLQ 199 Score = 36.6 bits (83), Expect(2) = 7e-09 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKTT 235 SSLISCYQLLPSP K+KT+ Sbjct: 217 SSLISCYQLLPSPPKSKTS 235 >ref|XP_004964390.1| PREDICTED: peroxisomal membrane protein 11-5-like [Setaria italica] Length = 233 Score = 51.6 bits (122), Expect(2) = 1e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KLQKSNER LAL+K+ +DIVVAVGLLQ Sbjct: 169 QYRMKLQKSNERLLALIKSSLDIVVAVGLLQ 199 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAK 229 SSLI+CYQLLPSP K+K Sbjct: 217 SSLIACYQLLPSPAKSK 233 >gb|EMJ19501.1| hypothetical protein PRUPE_ppa010803mg [Prunus persica] Length = 235 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QYR KL+KSNER+LALVKA MD VVA GLLQ Sbjct: 169 QYRAKLKKSNERSLALVKAAMDTVVAAGLLQ 199 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAKT 232 +SLISCYQLLP+P K+KT Sbjct: 217 TSLISCYQLLPAPAKSKT 234 >ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|567905332|ref|XP_006445154.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|567905334|ref|XP_006445155.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|568875864|ref|XP_006491010.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X1 [Citrus sinensis] gi|568875866|ref|XP_006491011.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X2 [Citrus sinensis] gi|568875868|ref|XP_006491012.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X3 [Citrus sinensis] gi|568875870|ref|XP_006491013.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X4 [Citrus sinensis] gi|557547415|gb|ESR58393.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|557547416|gb|ESR58394.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|557547417|gb|ESR58395.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] Length = 235 Score = 51.2 bits (121), Expect(2) = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQ 150 QY+ KL+KSNER+LALVK+ MDIVVAVGLLQ Sbjct: 169 QYQAKLKKSNERSLALVKSAMDIVVAVGLLQ 199 Score = 32.7 bits (73), Expect(2) = 2e-08 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +2 Query: 179 SSLISCYQLLPSPQKAK 229 +SLISCYQLLP+P KAK Sbjct: 217 TSLISCYQLLPAPVKAK 233