BLASTX nr result
ID: Rehmannia26_contig00000569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00000569 (591 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004516042.1| PREDICTED: proteinase inhibitor type-2 CEVI5... 64 4e-08 >ref|XP_004516042.1| PREDICTED: proteinase inhibitor type-2 CEVI57-like [Cicer arietinum] Length = 79 Score = 63.5 bits (153), Expect = 4e-08 Identities = 31/71 (43%), Positives = 38/71 (53%), Gaps = 8/71 (11%) Frame = +1 Query: 265 LLLFITGVLVLGCNLQSTSSKACPLYCXXXXXXXK--------LNPACNCCLAQPGCKIY 420 LL+ + G ++LG NL +K CPL C L+P CNCCLA GCKIY Sbjct: 9 LLVLVFGAILLGGNLNFVDAKVCPLICYDSAGYMTCPSSGDQHLSPPCNCCLASTGCKIY 68 Query: 421 TNTGTLICTGT 453 GTLICT + Sbjct: 69 KADGTLICTAS 79