BLASTX nr result
ID: Rehmannia25_contig00033017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00033017 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484927.1| PREDICTED: uncharacterized protein LOC102626... 55 7e-06 >ref|XP_006484927.1| PREDICTED: uncharacterized protein LOC102626623 [Citrus sinensis] Length = 417 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/64 (35%), Positives = 36/64 (56%) Frame = -3 Query: 196 HCLVWKLCTNKSLNSFYLLEVMKKSWKPKKGFSTREWGADLILFKFESEEDRDWVIANQP 17 HCLV K+ N+ +N L M+ +WK K G ++ +FKF +E+D+ V+ P Sbjct: 39 HCLVGKILLNRDVNKEGLRYAMQLAWKTTKEIKVESLGDNIFVFKFATEQDKKRVLTEGP 98 Query: 16 WHYD 5 WH+D Sbjct: 99 WHFD 102