BLASTX nr result
ID: Rehmannia25_contig00032962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00032962 (441 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346881.1| PREDICTED: uncharacterized protein LOC102594... 60 3e-07 ref|XP_004233955.1| PREDICTED: uncharacterized protein LOC101267... 57 3e-06 >ref|XP_006346881.1| PREDICTED: uncharacterized protein LOC102594864 [Solanum tuberosum] Length = 347 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/62 (53%), Positives = 43/62 (69%) Frame = -2 Query: 188 ISMATAVVEPLANHHSVTPIMTLPNPKPIRVCFSYAAYAKNLIDYLCSSNIPVEAGLSEA 9 ++MA + E L+ PI + NPKP +VCFSYAAYAKN+I +L SSN+ VE GLS+ Sbjct: 7 LAMAATLAETLS------PIK-IYNPKPTKVCFSYAAYAKNVIQHLKSSNLIVEKGLSDV 59 Query: 8 EF 3 EF Sbjct: 60 EF 61 >ref|XP_004233955.1| PREDICTED: uncharacterized protein LOC101267773 [Solanum lycopersicum] Length = 330 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 113 PKPIRVCFSYAAYAKNLIDYLCSSNIPVEAGLSEAEF 3 PKP +VCFSYAAYAKN+I +L SSN+ VE GLS+ EF Sbjct: 17 PKPTKVCFSYAAYAKNVIQHLKSSNLIVEKGLSDVEF 53