BLASTX nr result
ID: Rehmannia25_contig00032774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00032774 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006465531.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 61 1e-07 ref|XP_006465530.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 61 1e-07 ref|XP_006427014.1| hypothetical protein CICLE_v10025305mg [Citr... 60 3e-07 ref|XP_006427013.1| hypothetical protein CICLE_v10025305mg [Citr... 60 3e-07 >ref|XP_006465531.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X2 [Citrus sinensis] Length = 542 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/116 (29%), Positives = 65/116 (56%), Gaps = 1/116 (0%) Frame = -2 Query: 346 FGGNTEAFMSVLHNTLQRYYDQKLYLQKFYIAMSLVDSEPLS-LLEKWIPRILIDMGVRT 170 F + FM + +L R+ K +QKF + ++ +D + + ++++WI R+ ++ GVR Sbjct: 79 FSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWI-RLAVENGVRE 137 Query: 169 FDLSSLSLKPACFDFPSVVFEAESLKHLYLESCKLNPKPLDKVMFNHLKALSLKRV 2 D +++ + + P +F A S+ +L L C+L +P D +M LK L+L+RV Sbjct: 138 LDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLE-QPFDSIMLRSLKKLTLERV 192 >ref|XP_006465530.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Citrus sinensis] Length = 551 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/116 (29%), Positives = 65/116 (56%), Gaps = 1/116 (0%) Frame = -2 Query: 346 FGGNTEAFMSVLHNTLQRYYDQKLYLQKFYIAMSLVDSEPLS-LLEKWIPRILIDMGVRT 170 F + FM + +L R+ K +QKF + ++ +D + + ++++WI R+ ++ GVR Sbjct: 88 FSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWI-RLAVENGVRE 146 Query: 169 FDLSSLSLKPACFDFPSVVFEAESLKHLYLESCKLNPKPLDKVMFNHLKALSLKRV 2 D +++ + + P +F A S+ +L L C+L +P D +M LK L+L+RV Sbjct: 147 LDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLE-QPFDSIMLRSLKKLTLERV 201 >ref|XP_006427014.1| hypothetical protein CICLE_v10025305mg [Citrus clementina] gi|557529004|gb|ESR40254.1| hypothetical protein CICLE_v10025305mg [Citrus clementina] Length = 551 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/116 (29%), Positives = 65/116 (56%), Gaps = 1/116 (0%) Frame = -2 Query: 346 FGGNTEAFMSVLHNTLQRYYDQKLYLQKFYIAMSLVDSEPLS-LLEKWIPRILIDMGVRT 170 F + FM + +L R+ K +QKF + ++ +D + + ++++WI R+ ++ GVR Sbjct: 88 FSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWI-RLAVENGVRE 146 Query: 169 FDLSSLSLKPACFDFPSVVFEAESLKHLYLESCKLNPKPLDKVMFNHLKALSLKRV 2 D +++ + + P +F A S+ +L L C+L +P D +M LK L+L+RV Sbjct: 147 LDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLE-QPFDSIMLCSLKKLTLERV 201 >ref|XP_006427013.1| hypothetical protein CICLE_v10025305mg [Citrus clementina] gi|557529003|gb|ESR40253.1| hypothetical protein CICLE_v10025305mg [Citrus clementina] Length = 542 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/116 (29%), Positives = 65/116 (56%), Gaps = 1/116 (0%) Frame = -2 Query: 346 FGGNTEAFMSVLHNTLQRYYDQKLYLQKFYIAMSLVDSEPLS-LLEKWIPRILIDMGVRT 170 F + FM + +L R+ K +QKF + ++ +D + + ++++WI R+ ++ GVR Sbjct: 79 FSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWI-RLAVENGVRE 137 Query: 169 FDLSSLSLKPACFDFPSVVFEAESLKHLYLESCKLNPKPLDKVMFNHLKALSLKRV 2 D +++ + + P +F A S+ +L L C+L +P D +M LK L+L+RV Sbjct: 138 LDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLE-QPFDSIMLCSLKKLTLERV 192