BLASTX nr result
ID: Rehmannia25_contig00032053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00032053 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58317.1| hypothetical protein M569_16498, partial [Genlise... 55 7e-06 >gb|EPS58317.1| hypothetical protein M569_16498, partial [Genlisea aurea] Length = 194 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 239 MLPMDPTKKLSFNRRITNGDLVIVYERYDSM 331 MLP+DP KLSFNRRIT GDLVIVYER+DSM Sbjct: 1 MLPVDPAVKLSFNRRITAGDLVIVYERHDSM 31