BLASTX nr result
ID: Rehmannia25_contig00031810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031810 (649 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containi... 87 5e-15 ref|XP_002518061.1| pentatricopeptide repeat-containing protein,... 74 5e-11 ref|XP_006358268.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_006490098.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 ref|XP_006858679.1| hypothetical protein AMTR_s00066p00082400 [A... 67 6e-09 gb|EOY22910.1| Tetratricopeptide repeat-like superfamily protein... 67 6e-09 ref|XP_006858678.1| hypothetical protein AMTR_s00066p00081840 [A... 66 1e-08 ref|XP_006421694.1| hypothetical protein CICLE_v10004237mg [Citr... 65 1e-08 ref|XP_004235420.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 gb|EEC66478.1| hypothetical protein OsI_32564 [Oryza sativa Indi... 62 1e-07 gb|EAZ15116.1| hypothetical protein OsJ_30529 [Oryza sativa Japo... 62 1e-07 gb|AAL34928.1|AC079037_1 Putative PPR-repeat protein [Oryza sati... 59 9e-07 ref|XP_003571953.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_006384788.1| hypothetical protein POPTR_0004s21110g [Popu... 59 2e-06 ref|XP_002328242.1| predicted protein [Populus trichocarpa] 59 2e-06 ref|XP_006282365.1| hypothetical protein CARUB_v10028662mg [Caps... 58 2e-06 ref|XP_002866485.1| pentatricopeptide repeat-containing protein ... 58 3e-06 ref|NP_201043.1| pentatricopeptide repeat-containing protein [Ar... 56 8e-06 >ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Vitis vinifera] Length = 1101 Score = 86.7 bits (213), Expect = 5e-15 Identities = 38/75 (50%), Positives = 52/75 (69%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRG P+KSSYEKLL LCA VHA +IFE+M+ H+Y PC YN WL ILC++++ Sbjct: 903 KRGLFPNKSSYEKLLKCLCASHLGVHAFKIFEEMLSHDYVPCWYNCNWLLCILCEEHRWH 962 Query: 467 KAQAMCDMLLNRRNY 423 +A + D++L +R Y Sbjct: 963 EAHIVFDVMLKQRKY 977 >ref|XP_002518061.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542657|gb|EEF44194.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 403 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/72 (43%), Positives = 48/72 (66%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF P+K+SYE L+ CA S+ A ++FE+M+ HNY P +Y +WL IL ++ +L Sbjct: 304 KRGFFPNKASYENLIRLFCARHLSIPAFKLFEEMLAHNYLPRQYTAEWLLHILHEEERLH 363 Query: 467 KAQAMCDMLLNR 432 ++ + DM+ NR Sbjct: 364 ESHIVLDMMHNR 375 >ref|XP_006358268.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Solanum tuberosum] Length = 1067 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/72 (48%), Positives = 48/72 (66%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K+G PSK+SYE LLS LCA VHAL+I DM+ + Y PC +N + L IL ++NK Sbjct: 906 KKGLAPSKASYESLLSSLCASNWRVHALKICHDMLANKYVPCGHNLKLLICILGEENKWH 965 Query: 467 KAQAMCDMLLNR 432 +A+ M D+LL + Sbjct: 966 EARFMYDLLLKK 977 >ref|XP_006490098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like isoform X1 [Citrus sinensis] gi|568873973|ref|XP_006490099.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like isoform X2 [Citrus sinensis] gi|568873975|ref|XP_006490100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like isoform X3 [Citrus sinensis] Length = 1004 Score = 69.7 bits (169), Expect = 7e-10 Identities = 30/72 (41%), Positives = 48/72 (66%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF+P K++YE LL CA+ S+ A +F++MI+H++ PC N WL +ILC++ Sbjct: 909 KRGFVPKKATYEHLLECFCANCLSIPAFNMFKEMIVHDHVPCLSNCNWLLNILCQEKHFH 968 Query: 467 KAQAMCDMLLNR 432 +AQ + D++ R Sbjct: 969 EAQIVLDVMHKR 980 >ref|XP_006858679.1| hypothetical protein AMTR_s00066p00082400 [Amborella trichopoda] gi|548862790|gb|ERN20146.1| hypothetical protein AMTR_s00066p00082400 [Amborella trichopoda] Length = 992 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/72 (40%), Positives = 48/72 (66%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K+GF+P+K SYE+LL L + + A +F++M++H PC+YNF L +LC++N+L Sbjct: 884 KKGFVPNKISYERLLDLLSVNGAIDLAFNLFQEMLMHGCAPCKYNFNRLICLLCEENRLR 943 Query: 467 KAQAMCDMLLNR 432 +A + D +L R Sbjct: 944 EAHFVFDAMLKR 955 >gb|EOY22910.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775655|gb|EOY22911.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775656|gb|EOY22912.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 1003 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/75 (40%), Positives = 45/75 (60%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRG +P K++YE LL+ CA + A +IFE+M+ N P Y++ WL ILC+ KL Sbjct: 898 KRGLIPRKATYENLLAHFCASYLCIPAFKIFEEMLASNVVPRPYSYNWLLCILCEQKKLR 957 Query: 467 KAQAMCDMLLNRRNY 423 +A + D ++ R Y Sbjct: 958 EAYIVFDTMIQRGKY 972 >ref|XP_006858678.1| hypothetical protein AMTR_s00066p00081840 [Amborella trichopoda] gi|548862789|gb|ERN20145.1| hypothetical protein AMTR_s00066p00081840 [Amborella trichopoda] Length = 992 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/72 (40%), Positives = 47/72 (65%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K+GF+PSK SY++LL L + + A +F++M++H PCRYNF L + C++N+L Sbjct: 884 KKGFVPSKISYDRLLEHLSVNGAIDLAFNLFQEMLMHGCAPCRYNFNRLICLFCEENRLR 943 Query: 467 KAQAMCDMLLNR 432 +A + D +L R Sbjct: 944 EAHFVFDAMLKR 955 >ref|XP_006421694.1| hypothetical protein CICLE_v10004237mg [Citrus clementina] gi|557523567|gb|ESR34934.1| hypothetical protein CICLE_v10004237mg [Citrus clementina] Length = 1004 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/72 (40%), Positives = 47/72 (65%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF+P K++YE LL CA+ S+ A +F++MI+H++ PC N WL +IL ++ Sbjct: 909 KRGFVPKKATYEHLLECFCANCLSIPAFNMFKEMIVHDHVPCLSNCNWLLNILFQEKHFH 968 Query: 467 KAQAMCDMLLNR 432 +AQ + D++ R Sbjct: 969 EAQIVLDVMHKR 980 >ref|XP_004235420.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Solanum lycopersicum] Length = 1081 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K+G PSK+SYE LLS LCA VHAL+I DM+ + Y PC +N + L IL ++NK Sbjct: 906 KKGLAPSKASYESLLSSLCASNWRVHALKICHDMLANKYVPCGHNLKLLICILGEENKWH 965 Query: 467 KAQ 459 +A+ Sbjct: 966 EAR 968 >gb|EEC66478.1| hypothetical protein OsI_32564 [Oryza sativa Indica Group] Length = 481 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/75 (40%), Positives = 45/75 (60%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF+PSK+SY+KL+ L A + L++FEDM+ Y P N+ L +L KD + Sbjct: 372 KRGFVPSKASYDKLMELLLAENAIDIVLQLFEDMLFQGYTPRYANYTSLLLVLAKDGRWS 431 Query: 467 KAQAMCDMLLNRRNY 423 +A + M+L +R Y Sbjct: 432 EADRIFTMMLKKRKY 446 >gb|EAZ15116.1| hypothetical protein OsJ_30529 [Oryza sativa Japonica Group] Length = 906 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/75 (40%), Positives = 45/75 (60%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF+PSK+SY+KL+ L A + L++FEDM+ Y P N+ L +L KD + Sbjct: 797 KRGFVPSKASYDKLMELLLAENAIDIVLQLFEDMLFQGYTPRYANYTSLLLVLAKDGRWS 856 Query: 467 KAQAMCDMLLNRRNY 423 +A + M+L +R Y Sbjct: 857 EADRIFTMMLKKRKY 871 >gb|AAL34928.1|AC079037_1 Putative PPR-repeat protein [Oryza sativa] gi|31429883|gb|AAP51872.1| hypothetical protein LOC_Os10g02650 [Oryza sativa Japonica Group] Length = 949 Score = 59.3 bits (142), Expect = 9e-07 Identities = 29/73 (39%), Positives = 44/73 (60%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF+PSK+SY+KL+ L A + L++FEDM+ Y P N+ L +L KD + Sbjct: 820 KRGFVPSKASYDKLMELLLAENAIDIVLQLFEDMLFQGYTPRYANYTSLLLVLAKDGRWS 879 Query: 467 KAQAMCDMLLNRR 429 +A + M+L +R Sbjct: 880 EADRIFTMMLKKR 892 >ref|XP_003571953.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Brachypodium distachyon] Length = 926 Score = 59.3 bits (142), Expect = 9e-07 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF+PSK++Y+K++ L A S+ AL IF+DM H Y P N+ L +L KDN+ Sbjct: 817 KRGFVPSKAAYDKIMEQLLAENSTDLALNIFDDMFCHGYIPRYSNYSSLLLVLAKDNQWR 876 Query: 467 KAQAMCDMLLNR 432 + + M+L + Sbjct: 877 EVDRVFMMMLEK 888 >ref|XP_006384788.1| hypothetical protein POPTR_0004s21110g [Populus trichocarpa] gi|550341556|gb|ERP62585.1| hypothetical protein POPTR_0004s21110g [Populus trichocarpa] Length = 1025 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/72 (40%), Positives = 41/72 (56%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF P++ +YEK + CA S+ A RIFE+M+ N P Y L ILC++ KL Sbjct: 873 KRGFFPNRLAYEKSHHYFCAGHMSIPAFRIFEEMVACNLVPGLYRRNLLLYILCEEKKLH 932 Query: 467 KAQAMCDMLLNR 432 +A D++ R Sbjct: 933 EAYRASDVMFER 944 >ref|XP_002328242.1| predicted protein [Populus trichocarpa] Length = 893 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/72 (40%), Positives = 41/72 (56%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 KRGF P++ +YEK + CA S+ A RIFE+M+ N P Y L ILC++ KL Sbjct: 784 KRGFFPNRLAYEKSHHYFCAGHMSIPAFRIFEEMVACNLVPGLYRRNLLLYILCEEKKLH 843 Query: 467 KAQAMCDMLLNR 432 +A D++ R Sbjct: 844 EAYRASDVMFER 855 >ref|XP_006282365.1| hypothetical protein CARUB_v10028662mg [Capsella rubella] gi|482551069|gb|EOA15263.1| hypothetical protein CARUB_v10028662mg [Capsella rubella] Length = 983 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/65 (43%), Positives = 42/65 (64%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K+G P+K SYEKLL LC R ++ A+++ +DM Y+P N WL ILC++ KL Sbjct: 890 KQGIHPNKYSYEKLLQCLCYSRLTMEAVKVVKDMAALYYWPRSINHTWLIYILCEEKKLR 949 Query: 467 KAQAM 453 +A+A+ Sbjct: 950 EARAL 954 >ref|XP_002866485.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312320|gb|EFH42744.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 983 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K+G P+K SYEKLL LC R ++ A ++ +DM + +P N WL ILC++ KL Sbjct: 890 KKGIYPNKDSYEKLLQCLCYSRLTMEAFKVVKDMAALDIWPRSINHTWLIYILCEEKKLR 949 Query: 467 KAQAM 453 +A+A+ Sbjct: 950 EARAL 954 >ref|NP_201043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180621|sp|Q9LVA2.1|PP443_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g62370 gi|8809650|dbj|BAA97201.1| unnamed protein product [Arabidopsis thaliana] gi|332010218|gb|AED97601.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 982 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = -3 Query: 647 KRGFLPSKSSYEKLLSFLCAHRSSVHALRIFEDMILHNYFPCRYNFQWLNSILCKDNKLD 468 K G P+K SYEKLL LC R ++ A+++ +DM + +P N WL ILC++ KL Sbjct: 889 KSGINPNKDSYEKLLQCLCYSRLTMEAVKVVKDMAALDIWPRSINHTWLIYILCEEKKLR 948 Query: 467 KAQAM 453 +A+A+ Sbjct: 949 EARAL 953