BLASTX nr result
ID: Rehmannia25_contig00031581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031581 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006376306.1| hypothetical protein POPTR_0013s11850g [Popu... 73 3e-11 >ref|XP_006376306.1| hypothetical protein POPTR_0013s11850g [Populus trichocarpa] gi|550325582|gb|ERP54103.1| hypothetical protein POPTR_0013s11850g [Populus trichocarpa] Length = 285 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +3 Query: 3 PALTPEAPAFFNPFFLTMKLPPMKKLEDRAKTKPFILSDDIPL 131 PAL PEAPAFFNPFFLT+KL P+KKLED A T PF+LS DIPL Sbjct: 180 PALRPEAPAFFNPFFLTIKLAPIKKLEDNANTNPFMLSVDIPL 222