BLASTX nr result
ID: Rehmannia25_contig00031512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031512 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY00434.1| Retrotransposon protein, unclassified, putative [... 40 3e-06 >gb|EOY00434.1| Retrotransposon protein, unclassified, putative [Theobroma cacao] Length = 421 Score = 39.7 bits (91), Expect(3) = 3e-06 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -1 Query: 260 LHIMSCFILPTGLCEALDKVVAQFWWRSGM 171 +++MSCF LP LC +D V A++WW S + Sbjct: 240 IYVMSCFKLPDTLCAEIDSVYARYWWGSNV 269 Score = 31.2 bits (69), Expect(3) = 3e-06 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -2 Query: 328 KAALLSPAGKEVIIEAVFHAIPTYI-SC 248 K+ +LS GKEV+I+AV AIP Y+ SC Sbjct: 218 KSKVLSIVGKEVLIKAVAQAIPIYVMSC 245 Score = 24.6 bits (52), Expect(3) = 3e-06 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 168 KMHWVNWKALTWSK 127 K+HW +WKA+ SK Sbjct: 273 KIHWKSWKAICTSK 286