BLASTX nr result
ID: Rehmannia25_contig00031468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031468 (570 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60163.1| hypothetical protein M569_14640, partial [Genlise... 63 5e-08 ref|XP_006341672.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >gb|EPS60163.1| hypothetical protein M569_14640, partial [Genlisea aurea] Length = 449 Score = 63.2 bits (152), Expect = 5e-08 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = -1 Query: 570 EELFSKVQMSDLPIDHVPFMILMKKCFKMGELDKVFDLYLIWLRRGNR 427 E +F ++++S L +DHVPFMILMKK FKMGELD+V DLYL W G R Sbjct: 402 EWVFFELRISGLAVDHVPFMILMKKYFKMGELDRVHDLYLEWSATGIR 449 >ref|XP_006341672.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830-like [Solanum tuberosum] Length = 579 Score = 55.5 bits (132), Expect = 1e-05 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -1 Query: 570 EELFSKVQMSDLPIDHVPFMILMKKCFKMGELDKVFDLYLIWL 442 ++LF K+ S L +DHVPF+ILMK+ +MGE +KVFDL+ WL Sbjct: 532 DKLFGKLMASGLAVDHVPFLILMKRYCRMGEFNKVFDLHQKWL 574