BLASTX nr result
ID: Rehmannia25_contig00031381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031381 (358 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856966.1| hypothetical protein AMTR_s00832p00008210, p... 59 9e-07 >ref|XP_006856966.1| hypothetical protein AMTR_s00832p00008210, partial [Amborella trichopoda] gi|548861002|gb|ERN18433.1| hypothetical protein AMTR_s00832p00008210, partial [Amborella trichopoda] Length = 731 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/61 (47%), Positives = 35/61 (57%) Frame = +2 Query: 17 PMKIVVVRDIPVQMKNDCRVFVACYAEYFISGKQMSEEDFDIERERMRYTHLLYNHARLK 196 P IV V +P Q+ DC VFVA +AEYFI GK + DFD+E R R L Y + K Sbjct: 654 PFPIVAVDGLPEQVTADCGVFVASFAEYFIDGKPIPSSDFDVEIHRDRLAVLFYQYGMKK 713 Query: 197 Q 199 Q Sbjct: 714 Q 714