BLASTX nr result
ID: Rehmannia25_contig00031324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031324 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38041.1| hypothetical protein L484_020960 [Morus notabilis] 70 2e-10 emb|CBI22269.3| unnamed protein product [Vitis vinifera] 66 4e-09 ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_002305377.2| hypothetical protein POPTR_0004s12430g [Popu... 65 9e-09 ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_002532904.1| pentatricopeptide repeat-containing protein,... 65 9e-09 ref|XP_004155878.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004134328.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 gb|ESW11550.1| hypothetical protein PHAVU_008G039700g [Phaseolus... 60 3e-07 ref|XP_006338411.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_004491917.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006482717.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004232191.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_003621319.1| Pentatricopeptide repeat-containing protein ... 57 2e-06 ref|XP_006431260.1| hypothetical protein CICLE_v10011308mg [Citr... 56 4e-06 ref|XP_006290777.1| hypothetical protein CARUB_v10016882mg [Caps... 55 1e-05 >gb|EXB38041.1| hypothetical protein L484_020960 [Morus notabilis] Length = 599 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +1 Query: 58 SGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVP 195 SGASSIE+NDE HEFKV +HP+SDKIYQTI LNQ L+++ YVP Sbjct: 551 SGASSIEVNDEVHEFKVFHKSHPQSDKIYQTIGKLNQDLKRVEYVP 596 >emb|CBI22269.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKI 183 PSG SSIE++DE HEF V D +HPKSD+IY+TI+GL QH+ K+ Sbjct: 463 PSGGSSIEVDDEVHEFTVFDRSHPKSDRIYKTIDGLGQHINKL 505 >ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Vitis vinifera] Length = 594 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKI 183 PSG SSIE++DE HEF V D +HPKSD+IY+TI+GL QH+ K+ Sbjct: 548 PSGGSSIEVDDEVHEFTVFDRSHPKSDRIYKTIDGLGQHINKL 590 >ref|XP_002305377.2| hypothetical protein POPTR_0004s12430g [Populus trichocarpa] gi|550340897|gb|EEE85888.2| hypothetical protein POPTR_0004s12430g [Populus trichocarpa] Length = 604 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPSL 201 PSGASSIE++DE HEF V D +HPKSDKIYQ IN L L+++ VP + Sbjct: 554 PSGASSIEVDDEVHEFTVFDKSHPKSDKIYQMINRLGLDLKRVHVVPKV 602 >ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPSL 201 PSGASSIE+ +E HEF V D +HPKSD IYQ I+ L Q LR++ YVP + Sbjct: 554 PSGASSIEVEEEVHEFTVFDQSHPKSDDIYQMIDRLVQDLRQVGYVPMI 602 >ref|XP_002532904.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527338|gb|EEF29484.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 604 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVP 195 PSGASSIEL+DE HEF V D +HP++DKIYQ + L Q L+++AY P Sbjct: 554 PSGASSIELDDEVHEFTVFDKSHPETDKIYQILVKLGQDLKQVAYAP 600 >ref|XP_004155878.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Length = 561 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKI 183 PSGASSIE+N+E HEF V D +HPKSD IYQ INGL L+++ Sbjct: 512 PSGASSIEVNNEVHEFTVFDRSHPKSDNIYQVINGLRHELKQV 554 >ref|XP_004134328.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cucumis sativus] Length = 601 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKI 183 PSGASSIE+N+E HEF V D +HPKSD IYQ INGL L+++ Sbjct: 552 PSGASSIEVNNEVHEFTVFDRSHPKSDNIYQVINGLRHELKQV 594 >ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPSL 201 PSGASSIE+ +E HEF V D +HPKSD IY+ I+ L Q LR++ YVP + Sbjct: 554 PSGASSIEVEEEVHEFTVFDQSHPKSDDIYKMIDRLVQDLRQVGYVPMI 602 >gb|ESW11550.1| hypothetical protein PHAVU_008G039700g [Phaseolus vulgaris] Length = 604 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPSL 201 PSGASSIE+ +E HEF V D +HPKSD IY+ I+ L Q L+++ +VP + Sbjct: 554 PSGASSIEVEEEVHEFTVFDQSHPKSDDIYRMIDRLVQDLQEVEFVPMI 602 >ref|XP_006338411.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum tuberosum] Length = 602 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +1 Query: 58 SGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPS 198 SGAS + LNDE+ EF VMD +H KSDKIYQ ++ L QHL+ ++ VP+ Sbjct: 551 SGASLLLLNDEYREFTVMDKSHVKSDKIYQMVDRLGQHLKLLSPVPA 597 >ref|XP_004491917.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cicer arietinum] Length = 321 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVP 195 PSG SSIE+ +E H+F V+D +HPKS IY I+ L Q LR++ YVP Sbjct: 195 PSGVSSIEVEEEVHKFTVLDQSHPKSSDIYNMIDRLVQALRQVGYVP 241 >ref|XP_006482717.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Citrus sinensis] Length = 614 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPSL 201 PSGASS+E+++E HEF V D HPKS++IYQ IN L + L+ + + L Sbjct: 557 PSGASSVEVDNEVHEFSVCDQLHPKSEQIYQMINTLGKDLKPVGHAAKL 605 >ref|XP_004232191.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Solanum lycopersicum] Length = 602 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +1 Query: 58 SGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPS 198 SG S + LNDE+ EF VMD +H KSDKIYQ I+ L QHL+ ++ VP+ Sbjct: 551 SGGSLLLLNDEYREFTVMDKSHVKSDKIYQMIDRLGQHLKLLSPVPA 597 >ref|XP_003621319.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496334|gb|AES77537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 605 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAYVPSLV 204 PSG SSIE+ +E HEF V D +HPKS IY I+ L LR++ YVP L+ Sbjct: 556 PSGVSSIEVEEEVHEFTVRDWSHPKSGDIYNMIDRLVHDLRQVGYVPRLL 605 >ref|XP_006431260.1| hypothetical protein CICLE_v10011308mg [Citrus clementina] gi|557533317|gb|ESR44500.1| hypothetical protein CICLE_v10011308mg [Citrus clementina] Length = 614 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQHLRKIAY 189 PSGASS+E+++E HEF V D HPKS++IYQ IN L + L+ + + Sbjct: 557 PSGASSVEVDNEVHEFSVCDQLHPKSEQIYQMINTLGKDLKPVGH 601 >ref|XP_006290777.1| hypothetical protein CARUB_v10016882mg [Capsella rubella] gi|482559484|gb|EOA23675.1| hypothetical protein CARUB_v10016882mg [Capsella rubella] Length = 601 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 55 PSGASSIELNDEFHEFKVMDTTHPKSDKIYQTINGLNQ 168 PSGASS+EL D HEF +D +HPKSD+IYQ + LN+ Sbjct: 553 PSGASSVELEDGIHEFTALDKSHPKSDQIYQMLGSLNE 590