BLASTX nr result
ID: Rehmannia25_contig00031119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031119 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Glycine max] Length = 487 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 445 FEPNSEIYGAFIDGYVEQGNETIASKLRKEMLCKQM 338 F+PNSEIYGAF+DGYV GNE +A LRKEML QM Sbjct: 450 FQPNSEIYGAFVDGYVRHGNEEMAEALRKEMLQNQM 485