BLASTX nr result
ID: Rehmannia25_contig00031090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031090 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus pe... 64 2e-08 ref|XP_006476197.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 63 5e-08 gb|ESW33251.1| hypothetical protein PHAVU_001G055200g [Phaseolus... 61 1e-07 ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_006450554.1| hypothetical protein CICLE_v10008018mg [Citr... 60 4e-07 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] 56 6e-06 gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protei... 55 1e-05 gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isof... 55 1e-05 gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isof... 55 1e-05 >ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum lycopersicum] Length = 602 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +DFT +S++L DP + PGP LE A++ A I + L++FN FDS+PKPLFTL+ W +K Sbjct: 81 TDFTTLSEILRDPTIPPGPALENALDRAGIEVNECMFLQLFNHFDSSPKPLFTLYLWAEK 140 Query: 405 R 407 + Sbjct: 141 K 141 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 SDF+ I LL+DPAL G LE+A+N I P LL IF+ FD++PKPLFTLF W K Sbjct: 70 SDFSTICALLTDPALSSGAPLEDALNRTGIKPCSGLLQAIFSHFDASPKPLFTLFRWAMK 129 Query: 405 R 407 + Sbjct: 130 Q 130 >ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum tuberosum] Length = 604 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/61 (44%), Positives = 42/61 (68%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +DFT + ++L DP + GP LE A++ A + + L++FN FDS+PKPLFTL+ W +K Sbjct: 81 TDFTTLCEILRDPIIPAGPVLENALDRAGVEVNECMFLQLFNHFDSSPKPLFTLYLWAEK 140 Query: 405 R 407 + Sbjct: 141 K 141 >ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 582 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/61 (44%), Positives = 45/61 (73%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +DF+ I+KLL+DP++ PG L A++ I+P+P+L+ +F+ FDS+PK L TLF W ++ Sbjct: 55 NDFSTITKLLTDPSIFPGASLRSALDRVGIDPSPSLVQAVFDHFDSSPKLLHTLFVWAEE 114 Query: 405 R 407 + Sbjct: 115 Q 115 >gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/61 (45%), Positives = 42/61 (68%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +DF+ I+ +L+DP++ PG L+ A++ I P P LL +F+ FDS+PK L TLF W +K Sbjct: 82 NDFSTIANVLADPSISPGSSLQSALDRTGIEPGPCLLQAVFDHFDSSPKLLHTLFLWAEK 141 Query: 405 R 407 R Sbjct: 142 R 142 >ref|XP_006476197.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Citrus sinensis] Length = 551 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/61 (45%), Positives = 38/61 (62%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +DF+ IS LL +PA+ GP LE +N + P P LLL +F FD +PK L TLF W + Sbjct: 49 TDFSVISGLLRNPAISSGPSLESELNQTGVEPEPALLLAVFEHFDHSPKLLHTLFRWAES 108 Query: 405 R 407 + Sbjct: 109 K 109 >gb|ESW33251.1| hypothetical protein PHAVU_001G055200g [Phaseolus vulgaris] Length = 606 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = +3 Query: 222 LSDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQ 401 L+ F+ IS L +DP++ PGP L ++ + I P P LLL +F+RF S+PK L +LF W Q Sbjct: 79 LNAFSLISNLFTDPSVSPGPVLHAKLDRSAIEPDPALLLALFDRFGSSPKLLHSLFLWAQ 138 Query: 402 KR 407 R Sbjct: 139 TR 140 >ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like isoform X1 [Glycine max] Length = 622 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 240 ISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQKR 407 IS L +DP+L PGP L ++ A I P P LLL +F+RF S+PK L +LF W Q R Sbjct: 96 ISNLFADPSLSPGPALHAELDRAGIEPDPALLLAVFDRFGSSPKLLHSLFLWAQTR 151 >ref|XP_006450554.1| hypothetical protein CICLE_v10008018mg [Citrus clementina] gi|557553780|gb|ESR63794.1| hypothetical protein CICLE_v10008018mg [Citrus clementina] Length = 517 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/61 (44%), Positives = 37/61 (60%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +DF+ IS LL + A+ GP LE +N + P P LLL +F FD +PK L TLF W + Sbjct: 49 TDFSVISGLLRNTAISSGPSLESELNQTGVEPEPALLLAVFEHFDHSPKLLHTLFRWAES 108 Query: 405 R 407 + Sbjct: 109 K 109 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] gi|449503560|ref|XP_004162063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] Length = 615 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/62 (43%), Positives = 43/62 (69%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 +D + IS +LSD +++PG LE+A++ I P+ +LL +F+ FDS+PK L +LF W K Sbjct: 87 NDLSTISSILSDRSVRPGAALEDALDRTGIVPSSSLLEAVFDHFDSSPKFLHSLFLWAAK 146 Query: 405 RS 410 +S Sbjct: 147 KS 148 >gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] Length = 612 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/61 (39%), Positives = 42/61 (68%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 ++F IS++L++P + G L A++ I P+P+LL +F+ FDS+PK L++LF W +K Sbjct: 88 NEFAAISEVLTNPNISGGFSLHTALDRTGIEPSPSLLQAVFDHFDSSPKLLYSLFLWAEK 147 Query: 405 R 407 + Sbjct: 148 Q 148 >gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784121|gb|EOY31377.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 560 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/61 (44%), Positives = 38/61 (62%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 S+F+ IS LL + + G LE A++ +I+P P LL IF FDS+PK L LF W +K Sbjct: 28 SNFSIISNLLKNSTITSGSSLESALDQTEIDPDPGLLQAIFECFDSSPKLLHHLFLWAEK 87 Query: 405 R 407 + Sbjct: 88 K 88 >gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] Length = 584 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/61 (44%), Positives = 38/61 (62%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 S+F+ IS LL + + G LE A++ +I+P P LL IF FDS+PK L LF W +K Sbjct: 52 SNFSIISNLLKNSTITSGSSLESALDQTEIDPDPGLLQAIFECFDSSPKLLHHLFLWAEK 111 Query: 405 R 407 + Sbjct: 112 K 112 >gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784118|gb|EOY31374.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784120|gb|EOY31376.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 595 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/61 (44%), Positives = 38/61 (62%) Frame = +3 Query: 225 SDFTRISKLLSDPALQPGPDLEEAINAAQINPTPNLLLEIFNRFDSTPKPLFTLFNWTQK 404 S+F+ IS LL + + G LE A++ +I+P P LL IF FDS+PK L LF W +K Sbjct: 63 SNFSIISNLLKNSTITSGSSLESALDQTEIDPDPGLLQAIFECFDSSPKLLHHLFLWAEK 122 Query: 405 R 407 + Sbjct: 123 K 123