BLASTX nr result
ID: Rehmannia25_contig00031049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031049 (403 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63367.1| hypothetical protein M569_11418 [Genlisea aurea] 57 3e-06 >gb|EPS63367.1| hypothetical protein M569_11418 [Genlisea aurea] Length = 484 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/70 (48%), Positives = 42/70 (60%) Frame = +1 Query: 193 MAISVSIIRYSSSLLATKTPDFSLRRFLIFSTYSSMAAERFLTLLEKDEAPVERTLNTVK 372 M S IR +A K D ++R FS SS AAE F+ L KD VE+TL++VK Sbjct: 1 MLFHASSIRRYIPAIAGKFSDLAIRSSPFFSGNSSSAAEIFIAQLLKDPNNVEKTLDSVK 60 Query: 373 AKLDSRCITQ 402 AKLD+RCITQ Sbjct: 61 AKLDARCITQ 70