BLASTX nr result
ID: Rehmannia25_contig00031025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00031025 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635541.1| PREDICTED: AP2-like ethylene-responsive tran... 56 4e-06 ref|XP_003635476.1| PREDICTED: AP2-like ethylene-responsive tran... 56 4e-06 >ref|XP_003635541.1| PREDICTED: AP2-like ethylene-responsive transcription factor AIL6-like [Vitis vinifera] Length = 516 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = -2 Query: 443 FYHHNLFHHHYPSNLPASDGSNINPLNL-----MLPSPPEFFIWPHQSY 312 FYHHNLF+H + SN+ AS+ ++ +LP P EFFIWPHQSY Sbjct: 468 FYHHNLFNHLHSSNMGASNSPGTTSSSMPTPMALLPPPAEFFIWPHQSY 516 >ref|XP_003635476.1| PREDICTED: AP2-like ethylene-responsive transcription factor AIL6-like [Vitis vinifera] Length = 458 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = -2 Query: 443 FYHHNLFHHHYPSNLPASDGSNINPLNL-----MLPSPPEFFIWPHQSY 312 FYHHNLF+H + SN+ AS+ ++ +LP P EFFIWPHQSY Sbjct: 410 FYHHNLFNHLHSSNMGASNSPGTTSSSMPTPMALLPPPAEFFIWPHQSY 458