BLASTX nr result
ID: Rehmannia25_contig00030939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00030939 (379 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529405.1| hypothetical protein RCOM_0623850 [Ricinus c... 55 7e-06 >ref|XP_002529405.1| hypothetical protein RCOM_0623850 [Ricinus communis] gi|223531153|gb|EEF33001.1| hypothetical protein RCOM_0623850 [Ricinus communis] Length = 423 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/61 (37%), Positives = 36/61 (59%) Frame = +2 Query: 41 YQFWCEMCKVGANCLKVMLDHEKGKKHVNRLSRSDRNGRDKIAVLVNHAELLAEDGKNIT 220 ++FWCEMC++GA VM HEKGKKH+ +L NG + + A + A+D + + Sbjct: 341 FKFWCEMCRIGAYSAVVMEAHEKGKKHLAQLQELGENGEVAVVASSSEASMKAKDAEAVA 400 Query: 221 D 223 + Sbjct: 401 E 401