BLASTX nr result
ID: Rehmannia25_contig00030808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00030808 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346743.1| PREDICTED: putative uncharacterized protein ... 57 3e-06 >ref|XP_006346743.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like [Solanum tuberosum] Length = 1729 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/61 (40%), Positives = 42/61 (68%) Frame = +1 Query: 247 PNFIVQVRSDAPRAVKQVDTEAVIQKLKFQPQKSNVVASNYIAGTLFYEQWSEALETVVQ 426 PNF++Q+RS R + + + +I+KL F P+ S V + +++G+L Y+QWSE LE +V+ Sbjct: 52 PNFVIQLRS-GNRRINRYALDDLIEKLPFAPRSSFVFSKGFLSGSLMYDQWSETLEVIVK 110 Query: 427 L 429 L Sbjct: 111 L 111