BLASTX nr result
ID: Rehmannia25_contig00030755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00030755 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63667.1| hypothetical protein VITISV_013184 [Vitis vinifera] 56 4e-06 >emb|CAN63667.1| hypothetical protein VITISV_013184 [Vitis vinifera] Length = 530 Score = 56.2 bits (134), Expect = 4e-06 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 5/131 (3%) Frame = -3 Query: 396 FVGSSHGWLGLSNKRNHDFFLSNPLSRRHIKLPSIRSLPLPEE---NWTWPSGHGVLKII 226 + GSSHGWL ++ + L +P SR+ I+LP + L +P+ + + GVL Sbjct: 226 YCGSSHGWL-ITTDETNAVSLLHPFSRQVIRLPPLTRLKIPQRTVYGFEYHLHKGVLSAN 284 Query: 225 ISGSPDEDCRAMMSFGPERRLAFCCPGRSTEWTPIGALVHEDGEIDGLH--GITARSYED 52 + +PD D M+ +G ++ LAF G W I ++V +D +D + ++ +ED Sbjct: 285 PTSNPD-DFVLMVIYGHDKGLAFIKSG-DQNWAYIDSMVMKDDVLDSPYFLDLSLFGFED 342 Query: 51 YVYSRRERVFF 19 +Y RE F+ Sbjct: 343 VIYQERELQFY 353