BLASTX nr result
ID: Rehmannia25_contig00030454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00030454 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB28928.1| hypothetical protein L484_012687 [Morus notabilis] 55 1e-05 >gb|EXB28928.1| hypothetical protein L484_012687 [Morus notabilis] Length = 343 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/78 (41%), Positives = 43/78 (55%) Frame = -1 Query: 412 LRQMGSVNDYANEFRARVAQLPGLAPHVQLGLFLNGLKPENRVRLRPNDVVDLRTAMRVA 233 LRQ GSV +Y EF A V Q+P L LG F+ GLK R +R ++ D+ AM +A Sbjct: 47 LRQTGSVAEYIEEFVATVVQVPELPDPQALGYFMGGLKDVLRRCIRTHNPTDVSRAMELA 106 Query: 232 RSVEREIEFLSTGRVSGK 179 VE E+ +TG G+ Sbjct: 107 CDVEEELGIQTTGVFGGR 124