BLASTX nr result
ID: Rehmannia25_contig00030427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00030427 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002455756.1| hypothetical protein SORBIDRAFT_03g024240 [S... 67 3e-09 ref|XP_006482024.1| PREDICTED: protein kinase and PP2C-like doma... 64 3e-08 ref|XP_006482023.1| PREDICTED: protein kinase and PP2C-like doma... 64 3e-08 ref|XP_006430492.1| hypothetical protein CICLE_v10011248mg [Citr... 64 3e-08 ref|XP_006855175.1| hypothetical protein AMTR_s00051p00099980 [A... 64 3e-08 ref|XP_004968892.1| PREDICTED: protein kinase and PP2C-like doma... 64 3e-08 gb|AFW80872.1| hypothetical protein ZEAMMB73_778895 [Zea mays] 64 3e-08 ref|NP_001170745.1| uncharacterized protein LOC100384837 [Zea ma... 64 3e-08 ref|XP_002526206.1| protein kinase, putative [Ricinus communis] ... 64 3e-08 ref|XP_002323217.1| kinase family protein [Populus trichocarpa] ... 64 3e-08 ref|XP_006337959.1| PREDICTED: protein kinase and PP2C-like doma... 63 4e-08 ref|XP_006337958.1| PREDICTED: protein kinase and PP2C-like doma... 63 4e-08 ref|XP_006337957.1| PREDICTED: protein kinase and PP2C-like doma... 63 4e-08 ref|XP_004229056.1| PREDICTED: protein kinase and PP2C-like doma... 63 4e-08 ref|XP_002283443.1| PREDICTED: protein kinase and PP2C-like doma... 63 4e-08 ref|XP_002283436.1| PREDICTED: protein kinase and PP2C-like doma... 63 4e-08 gb|EOY08756.1| Kinase family protein / protein phosphatase 2C ( ... 63 5e-08 ref|XP_006575151.1| PREDICTED: protein kinase and PP2C-like doma... 62 8e-08 ref|XP_006575150.1| PREDICTED: protein kinase and PP2C-like doma... 62 8e-08 gb|ESW17500.1| hypothetical protein PHAVU_007G244300g [Phaseolus... 62 8e-08 >ref|XP_002455756.1| hypothetical protein SORBIDRAFT_03g024240 [Sorghum bicolor] gi|241927731|gb|EES00876.1| hypothetical protein SORBIDRAFT_03g024240 [Sorghum bicolor] Length = 652 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFLHPVSTAERIY Sbjct: 618 CSKRLATEAAERGSKDNITVIVVFLHPVSTAERIY 652 >ref|XP_006482024.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X2 [Citrus sinensis] Length = 620 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 586 CSKRLATEAAERGSKDNITVIVVFLQPVSTAERIY 620 >ref|XP_006482023.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X1 [Citrus sinensis] Length = 659 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 625 CSKRLATEAAERGSKDNITVIVVFLQPVSTAERIY 659 >ref|XP_006430492.1| hypothetical protein CICLE_v10011248mg [Citrus clementina] gi|557532549|gb|ESR43732.1| hypothetical protein CICLE_v10011248mg [Citrus clementina] Length = 659 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 625 CSKRLATEAAERGSKDNITVIVVFLQPVSTAERIY 659 >ref|XP_006855175.1| hypothetical protein AMTR_s00051p00099980 [Amborella trichopoda] gi|548858928|gb|ERN16642.1| hypothetical protein AMTR_s00051p00099980 [Amborella trichopoda] Length = 654 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 620 CSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY 654 >ref|XP_004968892.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like [Setaria italica] Length = 653 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 619 CSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY 653 >gb|AFW80872.1| hypothetical protein ZEAMMB73_778895 [Zea mays] Length = 63 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 29 CSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY 63 >ref|NP_001170745.1| uncharacterized protein LOC100384837 [Zea mays] gi|238007304|gb|ACR34687.1| unknown [Zea mays] Length = 652 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 618 CSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY 652 >ref|XP_002526206.1| protein kinase, putative [Ricinus communis] gi|223534484|gb|EEF36185.1| protein kinase, putative [Ricinus communis] Length = 657 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 623 CSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY 657 >ref|XP_002323217.1| kinase family protein [Populus trichocarpa] gi|222867847|gb|EEF04978.1| kinase family protein [Populus trichocarpa] Length = 661 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+VVFL PVSTAERIY Sbjct: 627 CSKRLATEAAERGSKDNITVIVVFLRPVSTAERIY 661 >ref|XP_006337959.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X3 [Solanum tuberosum] Length = 647 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+V+FL PVSTAERIY Sbjct: 613 CSKRLATEAAERGSKDNITVIVIFLRPVSTAERIY 647 >ref|XP_006337958.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X2 [Solanum tuberosum] Length = 653 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+V+FL PVSTAERIY Sbjct: 619 CSKRLATEAAERGSKDNITVIVIFLRPVSTAERIY 653 >ref|XP_006337957.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X1 [Solanum tuberosum] Length = 654 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+V+FL PVSTAERIY Sbjct: 620 CSKRLATEAAERGSKDNITVIVIFLRPVSTAERIY 654 >ref|XP_004229056.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like [Solanum lycopersicum] Length = 653 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+V+FL PVSTAERIY Sbjct: 619 CSKRLATEAAERGSKDNITVIVIFLRPVSTAERIY 653 >ref|XP_002283443.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform 2 [Vitis vinifera] Length = 669 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+V+FL PVSTAERIY Sbjct: 635 CSKRLATEAAERGSKDNITVIVIFLRPVSTAERIY 669 >ref|XP_002283436.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform 1 [Vitis vinifera] gi|297741696|emb|CBI32828.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS+DNITV+V+FL PVSTAERIY Sbjct: 625 CSKRLATEAAERGSKDNITVIVIFLRPVSTAERIY 659 >gb|EOY08756.1| Kinase family protein / protein phosphatase 2C ( PP2C) family protein isoform 1 [Theobroma cacao] Length = 659 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEAAE GS DNITV+VVFL PVSTAER+Y Sbjct: 625 CSKRLATEAAERGSRDNITVIVVFLRPVSTAERVY 659 >ref|XP_006575151.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X3 [Glycine max] Length = 560 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEA E GS+DNITV+VVFL PVSTAERIY Sbjct: 526 CSKRLATEAVERGSKDNITVIVVFLRPVSTAERIY 560 >ref|XP_006575150.1| PREDICTED: protein kinase and PP2C-like domain-containing protein-like isoform X2 [Glycine max] Length = 669 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEA E GS+DNITV+VVFL PVSTAERIY Sbjct: 635 CSKRLATEAVERGSKDNITVIVVFLRPVSTAERIY 669 >gb|ESW17500.1| hypothetical protein PHAVU_007G244300g [Phaseolus vulgaris] Length = 658 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 CSKRLATEAAECGSEDNITVVVVFLHPVSTAERIY 107 CSKRLATEA E GS+DNITV+VVFL PVSTAERIY Sbjct: 624 CSKRLATEAVERGSKDNITVIVVFLRPVSTAERIY 658