BLASTX nr result
ID: Rehmannia25_contig00030356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00030356 (350 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006377440.1| hypothetical protein POPTR_0011s05940g, part... 55 9e-06 >ref|XP_006377440.1| hypothetical protein POPTR_0011s05940g, partial [Populus trichocarpa] gi|550327730|gb|ERP55237.1| hypothetical protein POPTR_0011s05940g, partial [Populus trichocarpa] Length = 329 Score = 55.1 bits (131), Expect = 9e-06 Identities = 33/93 (35%), Positives = 50/93 (53%), Gaps = 1/93 (1%) Frame = +3 Query: 9 RKLTREERAKLVCSHCQGNGHLMKDCFYIHGFPDWY-KKPREQRGQSTANFVEMDHSTEK 185 R + E+ KL CSHC G+ H CF IHG+PDW+ +K ++ + +S + V+ K Sbjct: 210 RAIEEAEKDKLCCSHCNGSRHTRDTCFEIHGYPDWFLEKQKQSKARSNKHPVQ-----AK 264 Query: 186 LTSAQPKSAQSADIAGIIQQELAKYMSHLQLTK 284 LT+A + A +A I Q++ K L L K Sbjct: 265 LTTATEIPSSFAAMA-ISQKDHTKPSELLSLAK 296