BLASTX nr result
ID: Rehmannia25_contig00029809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00029809 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY19861.1| Two-component response regulator ARR8 [Theobroma ... 116 4e-24 ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Popu... 110 1e-22 ref|XP_004511028.1| PREDICTED: two-component response regulator ... 110 1e-22 emb|CBX43987.1| putative A-type response regulator 5 [Populus x ... 110 3e-22 emb|CBX43986.1| putative A-type response regulator 4 [Populus x ... 108 6e-22 ref|XP_002304794.1| type-a response regulator [Populus trichocarpa] 108 6e-22 ref|XP_006591196.1| PREDICTED: two-component response regulator ... 108 7e-22 ref|XP_006470938.1| PREDICTED: two-component response regulator ... 108 1e-21 gb|ESW20933.1| hypothetical protein PHAVU_005G027100g [Phaseolus... 107 2e-21 ref|XP_002513063.1| Two-component response regulator ARR8, putat... 106 3e-21 ref|XP_006420721.1| hypothetical protein CICLE_v10005987mg [Citr... 106 4e-21 gb|ESW05760.1| hypothetical protein PHAVU_011G207200g [Phaseolus... 104 1e-20 gb|EMJ21266.1| hypothetical protein PRUPE_ppa025335mg [Prunus pe... 103 2e-20 ref|XP_003545839.1| PREDICTED: two-component response regulator ... 103 3e-20 ref|XP_003541594.1| PREDICTED: two-component response regulator ... 101 9e-20 ref|XP_003627814.1| Two-component response regulator ARR8 [Medic... 100 3e-19 dbj|BAL43557.1| type-A response regulator [Petunia x hybrida] 99 6e-19 gb|AFK41171.1| unknown [Lotus japonicus] 98 1e-18 ref|XP_004233018.1| PREDICTED: two-component response regulator ... 97 2e-18 ref|XP_006355595.1| PREDICTED: two-component response regulator ... 97 2e-18 >gb|EOY19861.1| Two-component response regulator ARR8 [Theobroma cacao] Length = 188 Score = 116 bits (290), Expect = 4e-24 Identities = 59/81 (72%), Positives = 68/81 (83%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE IPSRIN CLE GAEEFFLKPVQ SDVNKLRPHLM+G R++ Q I+KRK Sbjct: 110 PVVIMSSENIPSRINRCLEDGAEEFFLKPVQLSDVNKLRPHLMKG--RSKEMQQNISKRK 167 Query: 229 PLEECLSPDRTRTRFNDLALV 167 +EE L+PDRTRTR+N+L +V Sbjct: 168 GMEEILTPDRTRTRYNELEVV 188 >ref|XP_002304795.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa] gi|550343560|gb|EEE79774.2| hypothetical protein POPTR_0003s19710g [Populus trichocarpa] Length = 193 Score = 110 bits (276), Expect = 1e-22 Identities = 55/78 (70%), Positives = 66/78 (84%), Gaps = 1/78 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQ SDVNKLRPHLM+G+C+ ++Q N NKRK Sbjct: 110 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEDQPN--NKRK 167 Query: 229 PLEECL-SPDRTRTRFND 179 +EE + SP RTR+R+N+ Sbjct: 168 GMEEIVNSPGRTRSRYNE 185 >ref|XP_004511028.1| PREDICTED: two-component response regulator ARR9-like [Cicer arietinum] Length = 179 Score = 110 bits (276), Expect = 1e-22 Identities = 51/76 (67%), Positives = 65/76 (85%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQQSDVNKL+PHL++ + + + +Q+I NKRK Sbjct: 103 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQQSDVNKLKPHLLKSRVKEEEEQSINNKRK 162 Query: 229 PLEECLSPDRTRTRFN 182 +EE SPD++RT+F+ Sbjct: 163 SMEENHSPDKSRTKFS 178 >emb|CBX43987.1| putative A-type response regulator 5 [Populus x canadensis] Length = 198 Score = 110 bits (274), Expect = 3e-22 Identities = 55/80 (68%), Positives = 66/80 (82%), Gaps = 3/80 (3%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQ--NIINK 236 PVVIMSSE +PSRIN CL+ GAEEFFLKPVQ SDVNKLRPHLM+G+C+ + ++ NK Sbjct: 114 PVVIMSSENVPSRINRCLKEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEEEEEDQPNNK 173 Query: 235 RKPLEECL-SPDRTRTRFND 179 RK +EE + SPDRTRTR+ND Sbjct: 174 RKGMEEIVNSPDRTRTRYND 193 >emb|CBX43986.1| putative A-type response regulator 4 [Populus x canadensis] Length = 193 Score = 108 bits (271), Expect = 6e-22 Identities = 54/78 (69%), Positives = 66/78 (84%), Gaps = 1/78 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQ SDVNKLRPHLM+G+C+ ++Q + NKRK Sbjct: 110 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEDQPS--NKRK 167 Query: 229 PLEECL-SPDRTRTRFND 179 +EE + SP RTR+R+N+ Sbjct: 168 GMEEIVNSPGRTRSRYNE 185 >ref|XP_002304794.1| type-a response regulator [Populus trichocarpa] Length = 193 Score = 108 bits (271), Expect = 6e-22 Identities = 54/78 (69%), Positives = 66/78 (84%), Gaps = 1/78 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQ SDVNKLRPHLM+G+C+ ++Q N NKRK Sbjct: 110 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEDQPN--NKRK 167 Query: 229 PLEECL-SPDRTRTRFND 179 +EE + SP RTR+R+++ Sbjct: 168 GMEEIVNSPGRTRSRYSE 185 >ref|XP_006591196.1| PREDICTED: two-component response regulator ARR9-like [Glycine max] Length = 187 Score = 108 bits (270), Expect = 7e-22 Identities = 53/81 (65%), Positives = 61/81 (75%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +P+RIN CLE GA+EFFLKPVQQSDVNKLRPHLM+ K + Q I NKRK Sbjct: 104 PVVIMSSENVPARINRCLEEGADEFFLKPVQQSDVNKLRPHLMKSKVKDGEDQQISNKRK 163 Query: 229 PLEECLSPDRTRTRFNDLALV 167 EE SPD+TRT+ +V Sbjct: 164 ETEESHSPDKTRTKMEPQKVV 184 >ref|XP_006470938.1| PREDICTED: two-component response regulator ARR9-like [Citrus sinensis] Length = 187 Score = 108 bits (269), Expect = 1e-21 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 1/78 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQ-QNIINKR 233 PVVIMSSE IPSRIN CLE GAEEFFLKPVQ +DVNKL+PHLM+G + N+ NI NKR Sbjct: 95 PVVIMSSENIPSRINRCLEEGAEEFFLKPVQLADVNKLKPHLMKGISKEINEPNNINNKR 154 Query: 232 KPLEECLSPDRTRTRFND 179 K LEE S DRTRTR ND Sbjct: 155 KGLEEIDSADRTRTRLND 172 >gb|ESW20933.1| hypothetical protein PHAVU_005G027100g [Phaseolus vulgaris] Length = 187 Score = 107 bits (266), Expect = 2e-21 Identities = 51/81 (62%), Positives = 63/81 (77%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GA+EFFLKPVQQSDVN+LRPHL++ K + + +Q I NKRK Sbjct: 104 PVVIMSSENVPSRINRCLEDGADEFFLKPVQQSDVNRLRPHLLKSKVKDEEEQQISNKRK 163 Query: 229 PLEECLSPDRTRTRFNDLALV 167 EE SP++TRT+ +V Sbjct: 164 ETEERHSPEKTRTKMEPQKVV 184 >ref|XP_002513063.1| Two-component response regulator ARR8, putative [Ricinus communis] gi|223548074|gb|EEF49566.1| Two-component response regulator ARR8, putative [Ricinus communis] Length = 197 Score = 106 bits (265), Expect = 3e-21 Identities = 54/75 (72%), Positives = 63/75 (84%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQ SDVNKL+PH+M+GK R +N+ N NKRK Sbjct: 114 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVNKLKPHMMKGKTR-ENEPN--NKRK 170 Query: 229 PLEECLSPDRTRTRF 185 +EE SP+RTRTR+ Sbjct: 171 GMEEIHSPERTRTRY 185 >ref|XP_006420721.1| hypothetical protein CICLE_v10005987mg [Citrus clementina] gi|557522594|gb|ESR33961.1| hypothetical protein CICLE_v10005987mg [Citrus clementina] Length = 187 Score = 106 bits (264), Expect = 4e-21 Identities = 56/78 (71%), Positives = 61/78 (78%), Gaps = 1/78 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCR-TQNQQNIINKR 233 PVVIMSSE IPSRIN CLE GAEEFFLKPVQ +DVNKL+PHLM+G + + NI NKR Sbjct: 95 PVVIMSSENIPSRINRCLEEGAEEFFLKPVQLADVNKLKPHLMKGISKEIKEPNNINNKR 154 Query: 232 KPLEECLSPDRTRTRFND 179 K LEE S DRTRTR ND Sbjct: 155 KGLEEIDSADRTRTRLND 172 >gb|ESW05760.1| hypothetical protein PHAVU_011G207200g [Phaseolus vulgaris] Length = 230 Score = 104 bits (259), Expect = 1e-20 Identities = 50/75 (66%), Positives = 62/75 (82%), Gaps = 1/75 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNII-NKR 233 PVVIMSSE +PSRIN CLE GAEEFFLKPVQQ+DVNKL+PHLM+ + + + +Q +I NKR Sbjct: 153 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRTKEEQEQPLINNKR 212 Query: 232 KPLEECLSPDRTRTR 188 K +EE SP++TR R Sbjct: 213 KDMEEIYSPNKTRLR 227 >gb|EMJ21266.1| hypothetical protein PRUPE_ppa025335mg [Prunus persica] Length = 185 Score = 103 bits (258), Expect = 2e-20 Identities = 50/78 (64%), Positives = 61/78 (78%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE PSRIN CLE GAEEFFLKPVQ SDVNKL+PH+++G+ N NKRK Sbjct: 106 PVVIMSSENEPSRINRCLEEGAEEFFLKPVQLSDVNKLKPHMLKGRAMEDQSNN--NKRK 163 Query: 229 PLEECLSPDRTRTRFNDL 176 +E+ +P+RTRT++NDL Sbjct: 164 VMEQTQTPERTRTKYNDL 181 >ref|XP_003545839.1| PREDICTED: two-component response regulator ARR8-like [Glycine max] Length = 179 Score = 103 bits (256), Expect = 3e-20 Identities = 48/74 (64%), Positives = 59/74 (79%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQQ+DVNKL+PHLM+ + + + Q NKRK Sbjct: 103 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRAKEEQDQPFNNKRK 162 Query: 229 PLEECLSPDRTRTR 188 +EE SP++TR + Sbjct: 163 DMEEIHSPNKTRIK 176 >ref|XP_003541594.1| PREDICTED: two-component response regulator ARR8-like [Glycine max] Length = 179 Score = 101 bits (252), Expect = 9e-20 Identities = 47/74 (63%), Positives = 59/74 (79%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQQ+DVNKL+PHLM+ + + + Q NKRK Sbjct: 103 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRAKEEQDQPFNNKRK 162 Query: 229 PLEECLSPDRTRTR 188 ++E SP++TR + Sbjct: 163 DMKEIHSPNKTRIK 176 >ref|XP_003627814.1| Two-component response regulator ARR8 [Medicago truncatula] gi|92885116|gb|ABE87636.1| Response regulator receiver [Medicago truncatula] gi|355521836|gb|AET02290.1| Two-component response regulator ARR8 [Medicago truncatula] gi|388516389|gb|AFK46256.1| unknown [Medicago truncatula] Length = 177 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/74 (66%), Positives = 60/74 (81%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PVVIMSSE +PSRIN CLE GAEEFFLKPVQ SDV+KL+PHL++ K + +N+Q I KRK Sbjct: 103 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVSKLKPHLLKSKVKEENEQPI--KRK 160 Query: 229 PLEECLSPDRTRTR 188 +EE SPD+TR + Sbjct: 161 GMEETQSPDKTRPK 174 >dbj|BAL43557.1| type-A response regulator [Petunia x hybrida] Length = 227 Score = 99.0 bits (245), Expect = 6e-19 Identities = 57/123 (46%), Positives = 65/123 (52%), Gaps = 42/123 (34%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRT----------- 263 PVVIMSSE +PSRIN CLE GAEEFFLKPV+ SDVNKLRPH+M+ KC+T Sbjct: 105 PVVIMSSENVPSRINRCLEEGAEEFFLKPVRLSDVNKLRPHMMKSKCKTHQEEVAEKIVT 164 Query: 262 -------------------------------QNQQNIINKRKPLEECLSPDRTRTRFNDL 176 Q Q NKRK +EE LSPDRTR R+N L Sbjct: 165 VEKQESIEIAHVPSQIPQTQAQTESDAVQQQQKSQANSNKRKAMEENLSPDRTRPRYNGL 224 Query: 175 ALV 167 + Sbjct: 225 TAI 227 >gb|AFK41171.1| unknown [Lotus japonicus] Length = 174 Score = 97.8 bits (242), Expect = 1e-18 Identities = 50/75 (66%), Positives = 60/75 (80%), Gaps = 1/75 (1%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCR-TQNQQNIINKR 233 PVVIMSSE +PSRIN CLE GAEEFFLKPVQ SDV+KL+PHLM+ + + Q++Q I NKR Sbjct: 97 PVVIMSSENVPSRINRCLEEGAEEFFLKPVQLSDVHKLKPHLMKSRVKEEQDRQPINNKR 156 Query: 232 KPLEECLSPDRTRTR 188 K EE SPD+TR + Sbjct: 157 KIKEEFHSPDKTRVK 171 >ref|XP_004233018.1| PREDICTED: two-component response regulator ARR9-like [Solanum lycopersicum] Length = 166 Score = 97.4 bits (241), Expect = 2e-18 Identities = 48/72 (66%), Positives = 56/72 (77%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PV+IMSSE +PSRIN CLE GAEEFFLKPVQQSDVN+++PHLMR K + KRK Sbjct: 82 PVIIMSSENVPSRINRCLEEGAEEFFLKPVQQSDVNRIKPHLMREKPNSL-------KRK 134 Query: 229 PLEECLSPDRTR 194 + EC+SPDRTR Sbjct: 135 AMVECISPDRTR 146 >ref|XP_006355595.1| PREDICTED: two-component response regulator ARR9-like [Solanum tuberosum] Length = 163 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/77 (62%), Positives = 58/77 (75%) Frame = -1 Query: 409 PVVIMSSEYIPSRINNCLEHGAEEFFLKPVQQSDVNKLRPHLMRGKCRTQNQQNIINKRK 230 PV+IMSSE +PSRIN CLE GAEEFFLKPVQQSDVN+++PHLMR K + KRK Sbjct: 82 PVIIMSSENVPSRINRCLEEGAEEFFLKPVQQSDVNRIKPHLMREKPNSL-------KRK 134 Query: 229 PLEECLSPDRTRTRFND 179 + EC+SPD+TR N+ Sbjct: 135 AMVECISPDKTRKYSNN 151