BLASTX nr result
ID: Rehmannia25_contig00029709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00029709 (396 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530041.1| protein phosphatase 2c, putative [Ricinus co... 55 7e-06 >ref|XP_002530041.1| protein phosphatase 2c, putative [Ricinus communis] gi|223530457|gb|EEF32341.1| protein phosphatase 2c, putative [Ricinus communis] Length = 718 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = +2 Query: 14 LIKKPAYDRLLLAVAKELVNLAVARGCLDDITVMIVDLNHFR 139 L KK + L+ KELVNLAV RG LDDITVMIVDLNHFR Sbjct: 363 LHKKKSSSTGLVGACKELVNLAVGRGSLDDITVMIVDLNHFR 404