BLASTX nr result
ID: Rehmannia25_contig00029353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00029353 (459 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77636.1| hypothetical protein VITISV_013880 [Vitis vinifera] 55 7e-06 >emb|CAN77636.1| hypothetical protein VITISV_013880 [Vitis vinifera] Length = 230 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 2/81 (2%) Frame = -2 Query: 242 LVCSYCNKPGHTPEQCWRKAGKCLRCGSGQHQVKDCSVVVQRDKNAVT-LPQSGNK-NGS 69 ++C C K H C+R+ G C CG +H V+DC +KN +T P+ NK + Sbjct: 65 MICPTCGKK-HESRPCYREIGACFGCGKQRHMVRDC----PENKNFITGKPKEENKEDKQ 119 Query: 68 RPKMQGRVFALAGQEAPEAND 6 +P+ QGRVFA+ ++A +D Sbjct: 120 KPRAQGRVFAMTHRDAQATSD 140